Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2042965..2043290 | Replicon | chromosome |
Accession | NZ_CP120681 | ||
Organism | Bacillus subtilis strain DSM 10 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | P5655_RS11245 | Protein ID | WP_004398662.1 |
Coordinates | 2042965..2043144 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2043068..2043290 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5655_RS11235 (2042191) | 2042191..2042328 | - | 138 | WP_003229934.1 | hypothetical protein | - |
P5655_RS11240 (2042370) | 2042370..2042819 | - | 450 | WP_003229933.1 | phage portal protein | - |
P5655_RS11245 (2042965) | 2042965..2043144 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2043068) | 2043068..2043290 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2043068) | 2043068..2043290 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2043068) | 2043068..2043290 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2043068) | 2043068..2043290 | - | 223 | NuclAT_0 | - | Antitoxin |
P5655_RS11250 (2043524) | 2043524..2043613 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
P5655_RS11255 (2043867) | 2043867..2044310 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
P5655_RS11260 (2044313) | 2044313..2045713 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
P5655_RS11265 (2045714) | 2045714..2045905 | - | 192 | WP_010886574.1 | hypothetical protein | - |
P5655_RS11270 (2045902) | 2045902..2046339 | - | 438 | WP_003229927.1 | hypothetical protein | - |
P5655_RS11275 (2046352) | 2046352..2046855 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
P5655_RS11280 (2046852) | 2046852..2047214 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
P5655_RS11285 (2047211) | 2047211..2047606 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
P5655_RS11290 (2047610) | 2047610..2047921 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2010216..2063968 | 53752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T275365 WP_004398662.1 NZ_CP120681:2042965-2043144 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT275365 NZ_CP120681:c2043290-2043068 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|