Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2525928..2526253 | Replicon | chromosome |
| Accession | NZ_CP106673 | ||
| Organism | Bacillus subtilis strain SRCM116268 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | N7985_RS13000 | Protein ID | WP_128751232.1 |
| Coordinates | 2525928..2526107 (+) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2526031..2526253 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7985_RS12990 (2525154) | 2525154..2525291 | - | 138 | WP_021480099.1 | hypothetical protein | - |
| N7985_RS12995 (2525333) | 2525333..2525782 | - | 450 | WP_032722171.1 | phage portal protein | - |
| N7985_RS13000 (2525928) | 2525928..2526107 | + | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| - (2526031) | 2526031..2526253 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2526031) | 2526031..2526253 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2526031) | 2526031..2526253 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2526031) | 2526031..2526253 | - | 223 | NuclAT_0 | - | Antitoxin |
| N7985_RS13005 (2526487) | 2526487..2526576 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| N7985_RS13010 (2526830) | 2526830..2527273 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
| N7985_RS13015 (2527276) | 2527276..2528676 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| N7985_RS13020 (2528677) | 2528677..2528868 | - | 192 | WP_010886574.1 | hypothetical protein | - |
| N7985_RS13025 (2528865) | 2528865..2529302 | - | 438 | WP_003229927.1 | hypothetical protein | - |
| N7985_RS13030 (2529315) | 2529315..2529818 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| N7985_RS13035 (2529815) | 2529815..2530177 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| N7985_RS13040 (2530174) | 2530174..2530569 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
| N7985_RS13045 (2530573) | 2530573..2530884 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2493175..2546931 | 53756 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6755.19 Da Isoelectric Point: 8.0288
>T259624 WP_128751232.1 NZ_CP106673:2525928-2526107 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT259624 NZ_CP106673:c2526253-2526031 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|