Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2686043..2686368 | Replicon | chromosome |
Accession | NZ_CP115738 | ||
Organism | Bacillus subtilis strain W7 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OSK17_RS14155 | Protein ID | WP_128751232.1 |
Coordinates | 2686043..2686222 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2686146..2686368 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSK17_RS14145 (2685269) | 2685269..2685406 | - | 138 | WP_021480099.1 | hypothetical protein | - |
OSK17_RS14150 (2685448) | 2685448..2685897 | - | 450 | WP_032722171.1 | phage portal protein | - |
OSK17_RS14155 (2686043) | 2686043..2686222 | + | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2686146) | 2686146..2686368 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2686146) | 2686146..2686368 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2686146) | 2686146..2686368 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2686146) | 2686146..2686368 | - | 223 | NuclAT_0 | - | Antitoxin |
OSK17_RS14160 (2686602) | 2686602..2686691 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
OSK17_RS14165 (2686945) | 2686945..2687388 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
OSK17_RS14170 (2687391) | 2687391..2688791 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
OSK17_RS14175 (2688792) | 2688792..2688983 | - | 192 | WP_010886574.1 | hypothetical protein | - |
OSK17_RS14180 (2688980) | 2688980..2689417 | - | 438 | WP_003229927.1 | hypothetical protein | - |
OSK17_RS14185 (2689430) | 2689430..2689933 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
OSK17_RS14190 (2689930) | 2689930..2690292 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
OSK17_RS14195 (2690289) | 2690289..2690684 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
OSK17_RS14200 (2690688) | 2690688..2690999 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2653290..2707046 | 53756 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6755.19 Da Isoelectric Point: 8.0288
>T267368 WP_128751232.1 NZ_CP115738:2686043-2686222 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT267368 NZ_CP115738:c2686368-2686146 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|