Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2534126..2534451 | Replicon | chromosome |
Accession | NZ_CP120622 | ||
Organism | Bacillus subtilis strain DSM 1090 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | P5647_RS13070 | Protein ID | WP_004398662.1 |
Coordinates | 2534126..2534305 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2534229..2534451 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5647_RS13060 (2533352) | 2533352..2533489 | - | 138 | WP_003229934.1 | hypothetical protein | - |
P5647_RS13065 (2533531) | 2533531..2533980 | - | 450 | WP_003229933.1 | phage portal protein | - |
P5647_RS13070 (2534126) | 2534126..2534305 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2534229) | 2534229..2534451 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2534229) | 2534229..2534451 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2534229) | 2534229..2534451 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2534229) | 2534229..2534451 | - | 223 | NuclAT_0 | - | Antitoxin |
P5647_RS13075 (2534685) | 2534685..2534774 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
P5647_RS13080 (2535028) | 2535028..2535471 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
P5647_RS13085 (2535474) | 2535474..2536874 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
P5647_RS13090 (2536875) | 2536875..2537066 | - | 192 | WP_010886574.1 | hypothetical protein | - |
P5647_RS13095 (2537063) | 2537063..2537500 | - | 438 | WP_003229927.1 | hypothetical protein | - |
P5647_RS13100 (2537513) | 2537513..2538016 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
P5647_RS13105 (2538013) | 2538013..2538375 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
P5647_RS13110 (2538372) | 2538372..2538767 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
P5647_RS13115 (2538771) | 2538771..2539082 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2501376..2555129 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T275279 WP_004398662.1 NZ_CP120622:2534126-2534305 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT275279 NZ_CP120622:c2534451-2534229 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|