Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2195618..2195943 | Replicon | chromosome |
Accession | NZ_CP120598 | ||
Organism | Bacillus subtilis strain PRO115 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | P5622_RS11550 | Protein ID | WP_004398662.1 |
Coordinates | 2195764..2195943 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2195618..2195840 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5622_RS11505 (2190987) | 2190987..2191298 | + | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
P5622_RS11510 (2191302) | 2191302..2191697 | + | 396 | WP_004398566.1 | DUF3199 family protein | - |
P5622_RS11515 (2191694) | 2191694..2192056 | + | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
P5622_RS11520 (2192053) | 2192053..2192556 | + | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
P5622_RS11525 (2192569) | 2192569..2193006 | + | 438 | WP_003229927.1 | hypothetical protein | - |
P5622_RS11530 (2193003) | 2193003..2193194 | + | 192 | WP_010886574.1 | hypothetical protein | - |
P5622_RS11535 (2193195) | 2193195..2194595 | + | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
P5622_RS11540 (2194598) | 2194598..2195041 | + | 444 | WP_003229930.1 | phage tail tube protein | - |
P5622_RS11545 (2195295) | 2195295..2195384 | - | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
- (2195618) | 2195618..2195840 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2195618) | 2195618..2195840 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2195618) | 2195618..2195840 | + | 223 | NuclAT_0 | - | Antitoxin |
- (2195618) | 2195618..2195840 | + | 223 | NuclAT_0 | - | Antitoxin |
P5622_RS11550 (2195764) | 2195764..2195943 | - | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
P5622_RS11555 (2196089) | 2196089..2196538 | + | 450 | WP_003229933.1 | phage portal protein | - |
P5622_RS11560 (2196580) | 2196580..2196717 | + | 138 | WP_003229934.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2174939..2236637 | 61698 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T275235 WP_004398662.1 NZ_CP120598:c2195943-2195764 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT275235 NZ_CP120598:2195618-2195840 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|