Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2680044..2680369 | Replicon | chromosome |
Accession | NZ_CP112873 | ||
Organism | Bacillus subtilis strain O4 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | ORF34_RS14125 | Protein ID | WP_004398662.1 |
Coordinates | 2680044..2680223 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2680147..2680369 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORF34_RS14115 (2679270) | 2679270..2679407 | - | 138 | WP_003229934.1 | hypothetical protein | - |
ORF34_RS14120 (2679449) | 2679449..2679898 | - | 450 | WP_003229933.1 | phage portal protein | - |
ORF34_RS14125 (2680044) | 2680044..2680223 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2680147) | 2680147..2680369 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2680147) | 2680147..2680369 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2680147) | 2680147..2680369 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2680147) | 2680147..2680369 | - | 223 | NuclAT_0 | - | Antitoxin |
ORF34_RS14130 (2680603) | 2680603..2680692 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
ORF34_RS14135 (2680946) | 2680946..2681389 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
ORF34_RS14140 (2681392) | 2681392..2682792 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
ORF34_RS14145 (2682793) | 2682793..2682984 | - | 192 | WP_010886574.1 | hypothetical protein | - |
ORF34_RS14150 (2682981) | 2682981..2683418 | - | 438 | WP_003229927.1 | hypothetical protein | - |
ORF34_RS14155 (2683431) | 2683431..2683934 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
ORF34_RS14160 (2683931) | 2683931..2684293 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
ORF34_RS14165 (2684290) | 2684290..2684685 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
ORF34_RS14170 (2684689) | 2684689..2685000 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2647294..2719980 | 72686 | ||
inside | Prophage | - | - | 2649557..2704908 | 55351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T264916 WP_004398662.1 NZ_CP112873:2680044-2680223 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT264916 NZ_CP112873:c2680369-2680147 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|