Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2524047..2524372 | Replicon | chromosome |
Accession | NZ_CP113256 | ||
Organism | Bacillus subtilis strain K1 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | ORP33_RS13000 | Protein ID | WP_004398662.1 |
Coordinates | 2524047..2524226 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2524150..2524372 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORP33_RS12990 (2523273) | 2523273..2523410 | - | 138 | WP_021480099.1 | hypothetical protein | - |
ORP33_RS12995 (2523452) | 2523452..2523901 | - | 450 | WP_032722171.1 | phage portal protein | - |
ORP33_RS13000 (2524047) | 2524047..2524226 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2524150) | 2524150..2524372 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2524150) | 2524150..2524372 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2524150) | 2524150..2524372 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2524150) | 2524150..2524372 | - | 223 | NuclAT_0 | - | Antitoxin |
ORP33_RS13005 (2524606) | 2524606..2524695 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
ORP33_RS13010 (2524949) | 2524949..2525392 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
ORP33_RS13015 (2525395) | 2525395..2526795 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
ORP33_RS13020 (2526796) | 2526796..2526987 | - | 192 | WP_010886574.1 | hypothetical protein | - |
ORP33_RS13025 (2526984) | 2526984..2527421 | - | 438 | WP_003229927.1 | hypothetical protein | - |
ORP33_RS13030 (2527434) | 2527434..2527937 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
ORP33_RS13035 (2527934) | 2527934..2528296 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
ORP33_RS13040 (2528293) | 2528293..2528688 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
ORP33_RS13045 (2528692) | 2528692..2529003 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2491294..2547562 | 56268 | ||
- | inside | Prophage | - | - | 2493557..2560816 | 67259 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T265662 WP_004398662.1 NZ_CP113256:2524047-2524226 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT265662 NZ_CP113256:c2524372-2524150 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|