Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2726766..2727091 | Replicon | chromosome |
Accession | NZ_OX419580 | ||
Organism | Bacillus subtilis isolate NRS6116 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | KJP60_RS14470 | Protein ID | WP_004398662.1 |
Coordinates | 2726766..2726945 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2726869..2727091 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJP60_RS14460 (2725992) | 2725992..2726129 | - | 138 | WP_003229934.1 | hypothetical protein | - |
KJP60_RS14465 (2726171) | 2726171..2726620 | - | 450 | WP_003229933.1 | phage portal protein | - |
KJP60_RS14470 (2726766) | 2726766..2726945 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2726869) | 2726869..2727091 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2726869) | 2726869..2727091 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2726869) | 2726869..2727091 | - | 223 | NuclAT_0 | - | Antitoxin |
- (2726869) | 2726869..2727091 | - | 223 | NuclAT_0 | - | Antitoxin |
KJP60_RS14475 (2727325) | 2727325..2727414 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
KJP60_RS14480 (2727668) | 2727668..2728111 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
KJP60_RS14485 (2728114) | 2728114..2729514 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
KJP60_RS14490 (2729515) | 2729515..2729706 | - | 192 | WP_010886574.1 | hypothetical protein | - |
KJP60_RS14495 (2729703) | 2729703..2730140 | - | 438 | WP_003229927.1 | hypothetical protein | - |
KJP60_RS14500 (2730153) | 2730153..2730656 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
KJP60_RS14505 (2730653) | 2730653..2731015 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
KJP60_RS14510 (2731012) | 2731012..2731407 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
KJP60_RS14515 (2731411) | 2731411..2731722 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2694016..2747769 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T296945 WP_004398662.1 NZ_OX419580:2726766-2726945 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT296945 NZ_OX419580:c2727091-2726869 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|