Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-as-bsrH/- |
Location | 2516041..2516374 | Replicon | chromosome |
Accession | NZ_CP097130 | ||
Organism | Bacillus subtilis strain S16 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | M2M89_RS12875 | Protein ID | WP_004398662.1 |
Coordinates | 2516041..2516220 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 2516144..2516374 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2M89_RS12865 (2515267) | 2515267..2515404 | - | 138 | WP_021480099.1 | hypothetical protein | - |
M2M89_RS12870 (2515446) | 2515446..2515895 | - | 450 | WP_032722171.1 | phage portal protein | - |
M2M89_RS12875 (2516041) | 2516041..2516220 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- (2516144) | 2516144..2516374 | - | 231 | NuclAT_0 | - | Antitoxin |
- (2516144) | 2516144..2516374 | - | 231 | NuclAT_0 | - | Antitoxin |
- (2516144) | 2516144..2516374 | - | 231 | NuclAT_0 | - | Antitoxin |
- (2516144) | 2516144..2516374 | - | 231 | NuclAT_0 | - | Antitoxin |
M2M89_RS12880 (2516608) | 2516608..2516697 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
M2M89_RS12885 (2516951) | 2516951..2517394 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
M2M89_RS12890 (2517397) | 2517397..2518797 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
M2M89_RS12895 (2518798) | 2518798..2518989 | - | 192 | WP_010886574.1 | hypothetical protein | - |
M2M89_RS12900 (2518986) | 2518986..2519423 | - | 438 | WP_003229927.1 | hypothetical protein | - |
M2M89_RS12905 (2519436) | 2519436..2519939 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
M2M89_RS12910 (2519936) | 2519936..2520298 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
M2M89_RS12915 (2520295) | 2520295..2520690 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
M2M89_RS12920 (2520694) | 2520694..2521005 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2483287..2537052 | 53765 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T244823 WP_004398662.1 NZ_CP097130:2516041-2516220 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 231 bp
>AT244823 NZ_CP097130:c2516374-2516144 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACATTACCACTTGTTAAT
GTGTGTTACTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCC
TTTAATAGGAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACATTACCACTTGTTAAT
GTGTGTTACTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCC
TTTAATAGGAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|