Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2705013..2705338 | Replicon | chromosome |
| Accession | NZ_CP104097 | ||
| Organism | Bacillus subtilis strain GL-4 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | N1207_RS14225 | Protein ID | WP_128751232.1 |
| Coordinates | 2705013..2705192 (+) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2705116..2705338 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1207_RS14215 (2704239) | 2704239..2704376 | - | 138 | WP_021480099.1 | hypothetical protein | - |
| N1207_RS14220 (2704418) | 2704418..2704867 | - | 450 | WP_032722171.1 | phage portal protein | - |
| N1207_RS14225 (2705013) | 2705013..2705192 | + | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| - (2705116) | 2705116..2705338 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2705116) | 2705116..2705338 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2705116) | 2705116..2705338 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2705116) | 2705116..2705338 | - | 223 | NuclAT_0 | - | Antitoxin |
| N1207_RS14230 (2705572) | 2705572..2705661 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| N1207_RS14235 (2705915) | 2705915..2706358 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
| N1207_RS14240 (2706361) | 2706361..2707761 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| N1207_RS14245 (2707762) | 2707762..2707953 | - | 192 | WP_010886574.1 | hypothetical protein | - |
| N1207_RS14250 (2707950) | 2707950..2708387 | - | 438 | WP_003229927.1 | hypothetical protein | - |
| N1207_RS14255 (2708400) | 2708400..2708903 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| N1207_RS14260 (2708900) | 2708900..2709262 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| N1207_RS14265 (2709259) | 2709259..2709654 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
| N1207_RS14270 (2709658) | 2709658..2709969 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2672260..2726016 | 53756 | ||
| inside | Prophage | - | - | 2674522..2726016 | 51494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6755.19 Da Isoelectric Point: 8.0288
>T257161 WP_128751232.1 NZ_CP104097:2705013-2705192 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT257161 NZ_CP104097:c2705338-2705116 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|