Detailed information of TA system TA282350

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): bsrH-as-bsrH/-
• Location: 1619351..1619605
• Replicon: chromosome
• Accession: NZ_CP125762
• Organism: Bacillus subtilis strain KRS015

Toxin (Protein)

• Gene name: bsrH
• Uniprot ID: -
• Locus tag: QLQ05_RS08535
• Protein ID: WP_283296538.1
• Coordinates: 1619507..1619605 (-)
• Length: 33 a.a.

Antitoxin (RNA)

Gene name	as-bsrH
Locus tag	-
Coordinates	1619351..1619554 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QLQ05_RS08495	1615221..1615533	+	313	Protein_1658	YqbF domain-containing protein	-
QLQ05_RS08500	1615537..1615935	+	399	Protein_1659	DUF3199 family protein	-
QLQ05_RS08505	1615932..1616296	+	365	Protein_1660	YqbH/XkdH family protein	-
QLQ05_RS08510	1616293..1616797	+	505	Protein_1661	HK97 gp10 family phage protein	-
QLQ05_RS08515	1616810..1617247	+	438	WP_003229927.1	hypothetical protein	-
QLQ05_RS08520	1617244..1617435	+	192	WP_010886574.1	hypothetical protein	-
QLQ05_RS08525	1617436..1618838	+	1403	Protein_1664	phage tail sheath family protein	-
QLQ05_RS08530	1618841..1619286	+	446	Protein_1665	phage tail tube protein	-
-	1619351..1619554	+	204	-	-	Antitoxin
QLQ05_RS08535	1619507..1619605	-	99	WP_283296538.1	putative holin-like toxin	Toxin
QLQ05_RS08540	1619586..1619645	-	60	Protein_1667	hypothetical protein	-
-	1619869..1620092	+	224	NuclAT_1	-	-
-	1619869..1620092	+	224	NuclAT_1	-	-
-	1619869..1620092	+	224	NuclAT_1	-	-
-	1619869..1620092	+	224	NuclAT_1	-	-
QLQ05_RS08545	1620016..1620195	-	180	WP_004398662.1	type I toxin-antitoxin system toxin TxpA	-
QLQ05_RS08550	1620343..1620792	+	450	WP_003229933.1	phage portal protein	-
QLQ05_RS08555	1620829..1620972	+	144	WP_283296297.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_000964 Bacillus subtilis subsp. subtilis str. 168 Prophage TA006322, TA010201, TA020260 2645490..2699243 0.005	inside	Prophage	-	-	1551114..1662348	111234

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-17)

Sequences

Toxin

Protein

• Length: 33 a.a.
• Molecular weight: 3551.34 Da
• Isoelectric Point: 4.5869

>T282350 WP_283296538.1 NZ_CP125762:c1619605-1619507 [Bacillus subtilis]
MLMLAFGSFIIALLTYIKEEIDPPLELGKVKG

Nucleotide

• Length: 99 bp

Antitoxin

Nucleotide

• Length: 204 bp

>AT282350 NZ_CP125762:1619351-1619554 [Bacillus subtilis]
TTAGAAGTAATTCAAACCGTACCAAATGGAAACATGTATTTCTTTCAAAAGAAATGCATAAAATAAAAGAGACCCGGTTG
CCGCCGGGTCAGTATAAATGTTGGCCCATCAAGAGGGCTTGGCTTAACAACTTCATGAAAGTATTTAGGATAGACTTTAC
CCTTTTACTTTGCCGAGCTCAAGGGGTGGGTCTATTTCTTCTTT

Structures

Antitoxin