Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2696249..2696574 | Replicon | chromosome |
Accession | NZ_LN649259 | ||
Organism | Bacillus subtilis strain BS49 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | P54373 |
Locus tag | VV34_RS14265 | Protein ID | WP_004398662.1 |
Coordinates | 2696249..2696428 (+) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2696352..2696574 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV34_RS23070 | 2695475..2695612 | - | 138 | WP_003229934.1 | hypothetical protein | - |
VV34_RS14260 | 2695654..2696103 | - | 450 | WP_003229933.1 | phage portal protein | - |
VV34_RS14265 | 2696249..2696428 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
- | 2696352..2696574 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696352..2696574 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696352..2696574 | - | 223 | NuclAT_0 | - | Antitoxin |
- | 2696352..2696574 | - | 223 | NuclAT_0 | - | Antitoxin |
VV34_RS23695 | 2696808..2696897 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
VV34_RS14275 | 2697151..2697594 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
VV34_RS14280 | 2697597..2698997 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
VV34_RS14285 | 2698998..2699189 | - | 192 | WP_010886574.1 | hypothetical protein | - |
VV34_RS14290 | 2699186..2699623 | - | 438 | WP_003229927.1 | hypothetical protein | - |
VV34_RS14295 | 2699636..2700139 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
VV34_RS14300 | 2700136..2700498 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
VV34_RS14305 | 2700495..2700890 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
VV34_RS14310 | 2700894..2701205 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2663499..2717252 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T285517 WP_004398662.1 NZ_LN649259:2696249-2696428 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT285517 NZ_LN649259:c2696574-2696352 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|