Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2677590..2677915 | Replicon | chromosome |
| Accession | NZ_CP103783 | ||
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | P54373 |
| Locus tag | NYR92_RS14105 | Protein ID | WP_004398662.1 |
| Coordinates | 2677590..2677769 (+) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2677693..2677915 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS14095 (2676816) | 2676816..2676953 | - | 138 | WP_003229934.1 | hypothetical protein | - |
| NYR92_RS14100 (2676995) | 2676995..2677444 | - | 450 | WP_003229933.1 | phage portal protein | - |
| NYR92_RS14105 (2677590) | 2677590..2677769 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| - (2677693) | 2677693..2677915 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2677693) | 2677693..2677915 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2677693) | 2677693..2677915 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2677693) | 2677693..2677915 | - | 223 | NuclAT_0 | - | Antitoxin |
| NYR92_RS14110 (2678149) | 2678149..2678238 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| NYR92_RS14115 (2678492) | 2678492..2678935 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
| NYR92_RS14120 (2678938) | 2678938..2680338 | - | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| NYR92_RS14125 (2680339) | 2680339..2680530 | - | 192 | WP_010886574.1 | hypothetical protein | - |
| NYR92_RS14130 (2680527) | 2680527..2680964 | - | 438 | WP_003229927.1 | hypothetical protein | - |
| NYR92_RS14135 (2680977) | 2680977..2681480 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| NYR92_RS14140 (2681477) | 2681477..2681839 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| NYR92_RS14145 (2681836) | 2681836..2682231 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
| NYR92_RS14150 (2682235) | 2682235..2682546 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2636893..2698593 | 61700 | ||
| inside | Prophage | - | - | 2644840..2698593 | 53753 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T256660 WP_004398662.1 NZ_CP103783:2677590-2677769 [Bacillus subtilis subsp. subtilis str. 168]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT256660 NZ_CP103783:c2677915-2677693 [Bacillus subtilis subsp. subtilis str. 168]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
