Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 2069883..2070129 | Replicon | chromosome |
Accession | NC_000964 | ||
Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
T1TAdb ID | TA04734 |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | BSU_18978 | Protein ID | YP_009513965.1 |
Coordinates | 2069883..2069975 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 2069956..2070129 (-) |
Genomic Context
Location: 2065042..2065377 (336 bp)
Type: Others
Protein ID: NP_389777.1
Type: Others
Protein ID: NP_389777.1
Location: 2069883..2069975 (93 bp)
Type: Toxin
Protein ID: YP_009513965.1
Type: Toxin
Protein ID: YP_009513965.1
Location: 2065424..2069029 (3606 bp)
Type: Others
Protein ID: NP_389778.1
Type: Others
Protein ID: NP_389778.1
Location: 2069956..2070129 (174 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 2070244..2071086 (843 bp)
Type: Others
Protein ID: NP_389779.1
Type: Others
Protein ID: NP_389779.1
Location: 2071286..2071744 (459 bp)
Type: Others
Protein ID: NP_389780.1
Type: Others
Protein ID: NP_389780.1
Location: 2071754..2073556 (1803 bp)
Type: Others
Protein ID: NP_389781.1
Type: Others
Protein ID: NP_389781.1
Location: 2073658..2074215 (558 bp)
Type: Others
Protein ID: NP_389782.3
Type: Others
Protein ID: NP_389782.3
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BSU_18960 (BSU18960) | 2065042..2065377 | + | 336 | NP_389777.1 | putative bacteriophage protein; putative defective prophage 6 | - |
BSU_18970 (BSU18970) | 2065424..2069029 | - | 3606 | NP_389778.1 | putative phage repair NTPase with transmembrane helices; putative defective prophage 6 | - |
BSU_18978 (BSU18978) | 2069883..2069975 | + | 93 | YP_009513965.1 | type I toxin (BsrE/AsrE) | Toxin |
- | 2069956..2070129 | - | 174 | - | - | Antitoxin |
BSU_18980 (BSU18980) | 2070244..2071086 | - | 843 | NP_389779.1 | conserved protein of unknown function; putative defective prophage 6 | - |
BSU_18990 (BSU18990) | 2071286..2071744 | - | 459 | NP_389780.1 | antitoxin inhibiting Rnase RttL | - |
BSU_19000 (BSU19000) | 2071754..2073556 | - | 1803 | NP_389781.1 | phage toxin ribonuclease; putative defective prophage 6 | - |
BSU_19010 (BSU19010) | 2073658..2074215 | - | 558 | NP_389782.3 | putative phage protein; putative defective prophage 6 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2055868..2100350 | 44482 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T10200 YP_009513965.1 NC_000964:2069883-2069975 [Bacillus subtilis subsp. subtilis str. 168]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
>T10200 NC_000964:2069883-2069975 [Bacillus subtilis subsp. subtilis str. 168]
ATGTCAACATTCCAGGCATTAATGCTAATGCTTGCAATCGGGTCGTTTATAATCGCCCTATTGACGTATATAGAAAAAAT
AGACCTCCCTTGA
ATGTCAACATTCCAGGCATTAATGCTAATGCTTGCAATCGGGTCGTTTATAATCGCCCTATTGACGTATATAGAAAAAAT
AGACCTCCCTTGA
Antitoxin
Download Length: 174 bp
>AT10200 NC_000964:c2070129-2069956 [Bacillus subtilis subsp. subtilis str. 168]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T10201 | Bacillus subtilis subsp. subtilis str. 168 | 92 | 86.207 | 0.793 |
T10205 | Enterococcus faecalis V583 | 44.444 | 90 | 0.4 |
T10204 | Enterococcus faecalis V583 | 37.037 | 90 | 0.333 |
Showing 1 to 3 of 3 rows
Multiple sequence alignment
Loading, please wait
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
No matching records found |
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Download structure file
References
(1) Christin Meißner et al. (2016) In Vitro Characterization of the Type I Toxin-Antitoxin System bsrE/SR5 from Bacillus subtilis. The Journal of Biological Chemistry 291(2):560-71. [PubMed:26565032]