Detailed information of TA system TA010200

Experimentally validated

Overview

TA module

• Type: I
• Classification (family/domain): bsrE-as-bsrE/-
• Location: 2069883..2070129
• Replicon: chromosome
• Accession: NC_000964
• Organism: Bacillus subtilis subsp. subtilis str. 168
• T1TAdb ID: TA04734

Toxin (Protein)

• Gene name: bsrE
• Uniprot ID: -
• Locus tag: BSU_18978
• Protein ID: YP_009513965.1
• Coordinates: 2069883..2069975 (+)
• Length: 31 a.a.

Antitoxin (RNA)

Gene name	as-bsrE
Locus tag	-
Coordinates	2069956..2070129 (-)

Genomic Context

Location: 2065042..2065377 (336 bp)
Type: Others
Protein ID: NP_389777.1

Location: 2069883..2069975 (93 bp)
Type: Toxin
Protein ID: YP_009513965.1

Location: 2065424..2069029 (3606 bp)
Type: Others
Protein ID: NP_389778.1

Location: 2069956..2070129 (174 bp)
Type: Antitoxin
Protein ID: -

Location: 2070244..2071086 (843 bp)
Type: Others
Protein ID: NP_389779.1

Location: 2071286..2071744 (459 bp)
Type: Others
Protein ID: NP_389780.1

Location: 2071754..2073556 (1803 bp)
Type: Others
Protein ID: NP_389781.1

Location: 2073658..2074215 (558 bp)
Type: Others
Protein ID: NP_389782.3

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BSU_18960 (BSU18960)	2065042..2065377	+	336	NP_389777.1	putative bacteriophage protein; putative defective prophage 6	-
BSU_18970 (BSU18970)	2065424..2069029	-	3606	NP_389778.1	putative phage repair NTPase with transmembrane helices; putative defective prophage 6	-
BSU_18978 (BSU18978)	2069883..2069975	+	93	YP_009513965.1	type I toxin (BsrE/AsrE)	Toxin
-	2069956..2070129	-	174	-	-	Antitoxin
BSU_18980 (BSU18980)	2070244..2071086	-	843	NP_389779.1	conserved protein of unknown function; putative defective prophage 6	-
BSU_18990 (BSU18990)	2071286..2071744	-	459	NP_389780.1	antitoxin inhibiting Rnase RttL	-
BSU_19000 (BSU19000)	2071754..2073556	-	1803	NP_389781.1	phage toxin ribonuclease; putative defective prophage 6	-
BSU_19010 (BSU19010)	2073658..2074215	-	558	NP_389782.3	putative phage protein; putative defective prophage 6	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NZ_CP005997 Bacillus subtilis TO-A Prophage TA045156 1996421..2031007 0.008 View NZ_CP010053 Bacillus subtilis strain PS832 Prophage TA050302 2055628..2100110 0 View NZ_CP011115 Bacillus subtilis KCTC 1028 = ATCC 6051a strain KCTC 1028 Prophage TA053429 2055873..2100356 0 View NZ_CP015975 Bacillus subtilis subsp. subtilis strain delta6 Prophage TA064018 1896673..1930039 0.007 View NZ_CP020102 Bacillus subtilis strain NCIB 3610 Prophage TA074077 2055900..2100383 0 View NZ_CP020915 Bacillus subtilis strain 50-1 Prophage TA075683 576214..610799 0.006 View NZ_CP035394 Bacillus subtilis strain SRCM103696 Prophage TA117738 2036744..2070109 0.007 View NZ_CP047325 Bacillus subtilis strain GOT9 Prophage TA145975 3596678..3630044 0.008 View NZ_CP053102 Bacillus subtilis subsp. subtilis str. 168 Prophage TA156112 2055901..2100385 0 View NZ_CP058242 Bacillus subtilis strain SP1 Prophage TA166381 2055871..2100354 0 View NZ_CP089592 Bacillus subtilis strain Bsi Prophage TA228391 2060879..2121271 0.008 View NZ_CP094361 Bacillus subtilis strain NCIB 3610 Prophage TA239784 2051501..2111893 0.008 View NZ_CP120622 Bacillus subtilis strain DSM 1090 Prophage TA275277 2046160..2080746 0.006 View NZ_OX419567 Bacillus subtilis isolate NRS6107 Prophage TA296838 2075912..2120395 0	inside	Prophage	-	-	2055868..2100350	44482

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (1-24)

Sequences

Toxin

Protein

• Length: 31 a.a.
• Molecular weight: 3358.16 Da
• Isoelectric Point: 4.1840

>T10200 YP_009513965.1 NC_000964:2069883-2069975 [Bacillus subtilis subsp. subtilis str. 168]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP

Nucleotide

• Length: 93 bp

>T10200 NC_000964:2069883-2069975 [Bacillus subtilis subsp. subtilis str. 168]
ATGTCAACATTCCAGGCATTAATGCTAATGCTTGCAATCGGGTCGTTTATAATCGCCCTATTGACGTATATAGAAAAAAT
AGACCTCCCTTGA

Antitoxin

Nucleotide

• Length: 174 bp

>AT10200 NC_000964:c2070129-2069956 [Bacillus subtilis subsp. subtilis str. 168]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T10201	Bacillus subtilis subsp. subtilis str. 168	92	86.207	0.793
T10205	Enterococcus faecalis V583	44.444	90	0.4
T10204	Enterococcus faecalis V583	37.037	90	0.333

Showing 1 to 3 of 3 rows

10

rows per page

• ‹
• 1
• ›

Multiple sequence alignment

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

Source	ID	Structure
No matching records found

Antitoxin

References

(1) Christin Meißner et al. (2016) In Vitro Characterization of the Type I Toxin-Antitoxin System bsrE/SR5 from Bacillus subtilis. The Journal of Biological Chemistry 291(2):560-71. [PubMed:26565032]


 experimental literature