Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/(antitoxin) |
Location | 1914763..1915282 | Replicon | chromosome |
Accession | NC_012924 | ||
Organism | Streptococcus suis SC84 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A2K1SXY6 |
Locus tag | SSUSC84_RS09420 | Protein ID | WP_012775363.1 |
Coordinates | 1914763..1915020 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A0K2E7Z9 |
Locus tag | SSUSC84_RS09425 | Protein ID | WP_002939010.1 |
Coordinates | 1915022..1915282 (-) | Length | 87 a.a. |
Genomic Context
Type: Others
Protein ID: WP_012775361.1
Type: Others
Protein ID: WP_012027884.1
Type: Others
Protein ID: WP_009910909.1
Type: Toxin
Protein ID: WP_012775363.1
Type: Antitoxin
Protein ID: WP_002939010.1
Type: Others
Protein ID: WP_012028534.1
Type: Others
Protein ID: WP_012775364.1
Type: Others
Protein ID: WP_012028535.1
Type: Others
Protein ID: WP_012775365.1
Type: Others
Protein ID: WP_012775366.1
Type: Others
Protein ID: WP_012028536.1
Type: Others
Protein ID: WP_002939016.1
Type: Others
Protein ID: WP_012775367.1
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSUSC84_RS09405 (SSUSC84_1814) | 1911232..1912962 | - | 1731 | WP_012775361.1 | membrane protein | - |
SSUSC84_RS09410 (SSUSC84_1815) | 1913327..1914235 | - | 909 | WP_012027884.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
SSUSC84_RS09415 (SSUSC84_1816) | 1914219..1914749 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
SSUSC84_RS09420 (SSUSC84_1817) | 1914763..1915020 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | Toxin |
SSUSC84_RS09425 (SSUSC84_1818) | 1915022..1915282 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
SSUSC84_RS09430 (SSUSC84_1819) | 1915358..1915813 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
SSUSC84_RS09435 (SSUSC84_1820) | 1915820..1916149 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
SSUSC84_RS09440 (SSUSC84_1821) | 1916139..1916426 | - | 288 | WP_012028535.1 | hypothetical protein | - |
SSUSC84_RS09445 (SSUSC84_1822) | 1916524..1916892 | - | 369 | WP_012775365.1 | hypothetical protein | - |
SSUSC84_RS09450 (SSUSC84_1823) | 1916885..1917454 | - | 570 | WP_012775366.1 | ribonuclease M5 | - |
SSUSC84_RS09455 (SSUSC84_1824) | 1917438..1918220 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
SSUSC84_RS09460 (SSUSC84_1825) | 1918327..1918464 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
SSUSC84_RS09465 (SSUSC84_1826) | 1918632..1919627 | - | 996 | WP_012775367.1 | protein jag | - |
Associated MGEs
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1874993..1918220 | 43227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10346.81 Da Isoelectric Point: 7.2737
MGIHFTDDAWEDYLYWQGQDKKTLKRINKIIQDMQRHPFEGIAKPEPLKYDYQGAWSRRIDAENRLIYMVEADRLCILSL
KDHYR
Download Length: 258 bp
ATGGGAATCCATTTTACAGACGACGCCTGGGAAGACTATCTTTATTGGCAGGGTCAGGATAAGAAAACACTGAAGAGAAT
CAATAAGATTATCCAGGATATGCAGCGACATCCTTTTGAAGGCATTGCCAAACCAGAACCTTTGAAGTATGATTATCAAG
GTGCCTGGTCTCGGAGAATTGATGCGGAGAATCGGTTGATTTATATGGTGGAAGCTGATCGGTTGTGCATCCTGTCGCTA
AAGGATCATTATAGGTGA
Antitoxin
Download Length: 87 a.a. Molecular weight: 9980.36 Da Isoelectric Point: 5.7134
MEAIVYSHFRNHLKDYMKKVNDEFEPLVVVNKNPEEDIVVLSKSEWDSLQETLAVARNTYLSQKVLRGMAKVKTGQTQER
NLIEAD
Download Length: 261 bp
ATGGAAGCTATTGTATATTCCCATTTTCGAAATCACTTAAAGGACTATATGAAAAAGGTCAATGACGAGTTTGAACCTTT
GGTCGTGGTTAATAAAAATCCAGAGGAAGATATTGTTGTACTCTCAAAGAGTGAGTGGGATAGTTTACAAGAAACCCTCG
CTGTTGCTCGGAACACTTATCTGTCTCAAAAAGTCCTACGTGGTATGGCTAAAGTCAAAACGGGACAAACCCAAGAACGA
AACCTGATAGAGGCGGACTAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T728 | Streptococcus pneumoniae R6 | 75 | 100 | 0.75 |
T4918 | Actinobacillus pleuropneumoniae serovar 3 str. JL03 | 57.143 | 98.824 | 0.565 |
T6022 | Enterococcus faecium | 58.025 | 95.294 | 0.553 |
T6115 | Enterococcus faecium | 58.025 | 95.294 | 0.553 |
T10021 | Lacticaseibacillus rhamnosus 51B | 55.556 | 95.294 | 0.529 |
T6138 | Lactobacillus rhamnosus Lc 705 | 55.556 | 95.294 | 0.529 |
T6143 | Lactobacillus rhamnosus ATCC 8530 | 55.556 | 95.294 | 0.529 |
T6237 | Lactobacillus rhamnosus Lc 705 | 55.556 | 95.294 | 0.529 |
T10020 | Lacticaseibacillus rhamnosus strain 24 | 55.556 | 95.294 | 0.529 |
T6122 | Streptomyces coelicolor A3(2) | 51.22 | 97.619 | 0.5 |
Multiple sequence alignment
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
AT728 | Streptococcus pneumoniae R6 | 79.487 | 92.857 | 0.738 |
AT10182 | Aggregatibacter actinomycetemcomitans D11S 1 | 57.143 | 100 | 0.571 |
AT6115 | Enterococcus faecium | 45.238 | 97.674 | 0.442 |
AT6022 | Enterococcus faecium | 45.238 | 97.674 | 0.442 |
AT6143 | Lactobacillus rhamnosus ATCC 8530 | 40.964 | 96.512 | 0.395 |
AT6138 | Lactobacillus rhamnosus Lc 705 | 40.964 | 96.512 | 0.395 |
AT6237 | Lactobacillus rhamnosus Lc 705 | 40.964 | 96.512 | 0.395 |
AT10021 | Lacticaseibacillus rhamnosus 51B | 40.964 | 96.512 | 0.395 |
AT10020 | Lacticaseibacillus rhamnosus strain 24 | 40.964 | 96.512 | 0.395 |
AT4918 | Actinobacillus pleuropneumoniae serovar 3 str. JL03 | 33.333 | 100 | 0.337 |
Multiple sequence alignment
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K1SXY6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K2E7Z9 |
References
(1) Chengkun Zheng et al. (2015) Identification and characterization of the chromosomal yefM-yoeB toxin-antitoxin system of Streptococcus suis. Scientific Reports 5:13125. [PubMed:26272287]