Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1894290..1894896 | Replicon | chromosome |
Accession | NZ_CP102137 | ||
Organism | Streptococcus suis strain M104300_S20 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
Locus tag | NQZ96_RS09260 | Protein ID | WP_012775364.1 |
Coordinates | 1894290..1894619 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | D5AKB4 |
Locus tag | NQZ96_RS09265 | Protein ID | WP_012028535.1 |
Coordinates | 1894609..1894896 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ96_RS09230 (NQZ96_09230) | 1889702..1891432 | - | 1731 | WP_012775361.1 | membrane protein | - |
NQZ96_RS09235 (NQZ96_09235) | 1891797..1892669 | - | 873 | WP_012775362.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
NQZ96_RS09240 (NQZ96_09240) | 1892689..1893219 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
NQZ96_RS09245 (NQZ96_09245) | 1893233..1893490 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
NQZ96_RS09250 (NQZ96_09250) | 1893492..1893752 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NQZ96_RS09255 (NQZ96_09255) | 1893828..1894283 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
NQZ96_RS09260 (NQZ96_09260) | 1894290..1894619 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ96_RS09265 (NQZ96_09265) | 1894609..1894896 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
NQZ96_RS09270 (NQZ96_09270) | 1894994..1895362 | - | 369 | WP_012775453.1 | hypothetical protein | - |
NQZ96_RS09275 (NQZ96_09275) | 1895355..1895924 | - | 570 | WP_012775366.1 | ribonuclease M5 | - |
NQZ96_RS09280 (NQZ96_09280) | 1895908..1896690 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
NQZ96_RS09285 (NQZ96_09285) | 1896797..1896934 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
NQZ96_RS09290 (NQZ96_09290) | 1897102..1898097 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
NQZ96_RS09295 (NQZ96_09295) | 1898117..1898929 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
NQZ96_RS09300 (NQZ96_09300) | 1898913..1899272 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1853463..1896690 | 43227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T253215 WP_012775364.1 NZ_CP102137:c1894619-1894290 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z9A6F4 |