Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1862809..1863415 | Replicon | chromosome |
Accession | NZ_LR738721 | ||
Organism | Streptococcus suis isolate S10 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
Locus tag | GPW51_RS09350 | Protein ID | WP_012775364.1 |
Coordinates | 1862809..1863138 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | D5AKB4 |
Locus tag | GPW51_RS09355 | Protein ID | WP_012028535.1 |
Coordinates | 1863128..1863415 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPW51_RS09320 | 1858221..1859951 | - | 1731 | WP_012775361.1 | membrane protein | - |
GPW51_RS09325 | 1860316..1861224 | - | 909 | WP_012027884.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
GPW51_RS09330 | 1861208..1861738 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
GPW51_RS09335 | 1861752..1862009 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
GPW51_RS09340 | 1862011..1862271 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GPW51_RS09345 | 1862347..1862802 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
GPW51_RS09350 | 1862809..1863138 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GPW51_RS09355 | 1863128..1863415 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
GPW51_RS09360 | 1863513..1863881 | - | 369 | WP_012775453.1 | hypothetical protein | - |
GPW51_RS09365 | 1863874..1864443 | - | 570 | WP_012775366.1 | ribonuclease M5 | - |
GPW51_RS09370 | 1864427..1865209 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
GPW51_RS09375 | 1865316..1865453 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
GPW51_RS09380 | 1865621..1866616 | - | 996 | WP_012775367.1 | protein jag | - |
GPW51_RS09385 | 1866636..1867448 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
GPW51_RS09390 | 1867432..1867791 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1821982..1865209 | 43227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T288906 WP_012775364.1 NZ_LR738721:c1863138-1862809 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z9A6F4 |