Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1804217..1804823 Replicon chromosome
Accession NZ_LS483418
Organism Streptococcus suis strain NCTC10234

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag DQM62_RS09045 Protein ID WP_012775364.1
Coordinates 1804217..1804546 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag DQM62_RS09050 Protein ID WP_012028535.1
Coordinates 1804536..1804823 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM62_RS09015 1799629..1801359 - 1731 WP_012775361.1 membrane protein -
DQM62_RS09020 1801724..1802632 - 909 WP_012027884.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
DQM62_RS09025 1802616..1803146 - 531 WP_009910909.1 DUF1697 domain-containing protein -
DQM62_RS09030 1803160..1803417 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
DQM62_RS09035 1803419..1803679 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DQM62_RS09040 1803755..1804210 - 456 WP_012028534.1 8-oxo-dGTP diphosphatase -
DQM62_RS09045 1804217..1804546 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DQM62_RS09050 1804536..1804823 - 288 WP_012028535.1 hypothetical protein Antitoxin
DQM62_RS09055 1804921..1805289 - 369 WP_014917322.1 hypothetical protein -
DQM62_RS09060 1805282..1805851 - 570 WP_012775700.1 ribonuclease M5 -
DQM62_RS09065 1805835..1806617 - 783 WP_012028536.1 TatD family hydrolase -
DQM62_RS09070 1806724..1806861 - 138 WP_002939016.1 50S ribosomal protein L34 -
DQM62_RS09075 1807029..1808024 - 996 WP_012775367.1 protein jag -
DQM62_RS09080 1808044..1808856 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
DQM62_RS09085 1808840..1809199 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 1763382..1806617 43235


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T292535 WP_012775364.1 NZ_LS483418:c1804546-1804217 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT292535 WP_012028535.1 NZ_LS483418:c1804823-1804536 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References