Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1911030..1911636 Replicon chromosome
Accession NZ_CP102748
Organism Streptococcus suis strain Transconjugant cSFJ45

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag NWE21_RS09455 Protein ID WP_012775364.1
Coordinates 1911030..1911359 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag NWE21_RS09460 Protein ID WP_012028535.1
Coordinates 1911349..1911636 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWE21_RS09425 (NWE21_09435) 1906442..1908172 - 1731 WP_012775361.1 membrane protein -
NWE21_RS09430 (NWE21_09440) 1908537..1909409 - 873 WP_012775362.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NWE21_RS09435 (NWE21_09445) 1909429..1909959 - 531 WP_009910909.1 DUF1697 domain-containing protein -
NWE21_RS09440 (NWE21_09450) 1909973..1910230 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
NWE21_RS09445 (NWE21_09455) 1910232..1910492 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NWE21_RS09450 (NWE21_09460) 1910568..1911023 - 456 WP_012028534.1 8-oxo-dGTP diphosphatase -
NWE21_RS09455 (NWE21_09465) 1911030..1911359 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWE21_RS09460 (NWE21_09470) 1911349..1911636 - 288 WP_012028535.1 hypothetical protein Antitoxin
NWE21_RS09465 (NWE21_09475) 1911734..1912102 - 369 WP_012775453.1 hypothetical protein -
NWE21_RS09470 (NWE21_09480) 1912095..1912664 - 570 WP_012775366.1 ribonuclease M5 -
NWE21_RS09475 (NWE21_09485) 1912648..1913430 - 783 WP_012028536.1 TatD family hydrolase -
NWE21_RS09480 (NWE21_09490) 1913537..1913674 - 138 WP_002939016.1 50S ribosomal protein L34 -
NWE21_RS09485 (NWE21_09495) 1913842..1914837 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
NWE21_RS09490 (NWE21_09500) 1914857..1915669 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
NWE21_RS09495 (NWE21_09505) 1915653..1916012 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 1870203..1913430 43227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T254123 WP_012775364.1 NZ_CP102748:c1911359-1911030 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT254123 WP_012028535.1 NZ_CP102748:c1911636-1911349 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References