Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1894647..1895253 Replicon chromosome
Accession NZ_CP109941
Organism Streptococcus suis strain ID38828

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag OHM51_RS09325 Protein ID WP_012775364.1
Coordinates 1894647..1894976 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag OHM51_RS09330 Protein ID WP_012028535.1
Coordinates 1894966..1895253 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHM51_RS09295 (OHM51_09295) 1890059..1891789 - 1731 WP_012775361.1 membrane protein -
OHM51_RS09300 (OHM51_09300) 1892154..1893026 - 873 WP_012775362.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
OHM51_RS09305 (OHM51_09305) 1893046..1893576 - 531 WP_009910909.1 DUF1697 domain-containing protein -
OHM51_RS09310 (OHM51_09310) 1893590..1893847 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
OHM51_RS09315 (OHM51_09315) 1893849..1894109 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OHM51_RS09320 (OHM51_09320) 1894185..1894640 - 456 WP_012028534.1 8-oxo-dGTP diphosphatase -
OHM51_RS09325 (OHM51_09325) 1894647..1894976 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHM51_RS09330 (OHM51_09330) 1894966..1895253 - 288 WP_012028535.1 hypothetical protein Antitoxin
OHM51_RS09335 (OHM51_09335) 1895351..1895719 - 369 WP_012775453.1 hypothetical protein -
OHM51_RS09340 (OHM51_09340) 1895712..1896281 - 570 WP_012775366.1 ribonuclease M5 -
OHM51_RS09345 (OHM51_09345) 1896265..1897047 - 783 WP_012028536.1 TatD family hydrolase -
OHM51_RS09350 (OHM51_09350) 1897154..1897291 - 138 WP_002939016.1 50S ribosomal protein L34 -
OHM51_RS09355 (OHM51_09355) 1897459..1898454 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
OHM51_RS09360 (OHM51_09360) 1898474..1899286 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
OHM51_RS09365 (OHM51_09365) 1899270..1899629 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 1853820..1897047 43227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T262470 WP_012775364.1 NZ_CP109941:c1894976-1894647 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT262470 WP_012028535.1 NZ_CP109941:c1895253-1894966 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References