Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1916200..1916806 | Replicon | chromosome |
| Accession | NZ_CP109942 | ||
| Organism | Streptococcus suis strain ID35541 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
| Locus tag | OHM48_RS09435 | Protein ID | WP_012775364.1 |
| Coordinates | 1916200..1916529 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | D5AKB4 |
| Locus tag | OHM48_RS09440 | Protein ID | WP_012028535.1 |
| Coordinates | 1916519..1916806 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHM48_RS09405 (OHM48_09405) | 1911612..1913342 | - | 1731 | WP_012775361.1 | membrane protein | - |
| OHM48_RS09410 (OHM48_09410) | 1913707..1914579 | - | 873 | WP_012775362.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| OHM48_RS09415 (OHM48_09415) | 1914599..1915129 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
| OHM48_RS09420 (OHM48_09420) | 1915143..1915400 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
| OHM48_RS09425 (OHM48_09425) | 1915402..1915662 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OHM48_RS09430 (OHM48_09430) | 1915738..1916193 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
| OHM48_RS09435 (OHM48_09435) | 1916200..1916529 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OHM48_RS09440 (OHM48_09440) | 1916519..1916806 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
| OHM48_RS09445 (OHM48_09445) | 1916904..1917272 | - | 369 | WP_012775453.1 | hypothetical protein | - |
| OHM48_RS09450 (OHM48_09450) | 1917265..1917834 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
| OHM48_RS09455 (OHM48_09455) | 1917818..1918600 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
| OHM48_RS09460 (OHM48_09460) | 1918707..1918844 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| OHM48_RS09465 (OHM48_09465) | 1919012..1920007 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| OHM48_RS09470 (OHM48_09470) | 1920027..1920839 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
| OHM48_RS09475 (OHM48_09475) | 1920823..1921182 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1875488..1918600 | 43112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T262477 WP_012775364.1 NZ_CP109942:c1916529-1916200 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z9A6F4 |