Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1826946..1827552 | Replicon | chromosome |
Accession | NZ_CP102154 | ||
Organism | Streptococcus suis strain SS15055_N2_C15 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
Locus tag | NQZ87_RS08935 | Protein ID | WP_012775364.1 |
Coordinates | 1826946..1827275 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | D5AKB4 |
Locus tag | NQZ87_RS08940 | Protein ID | WP_012028535.1 |
Coordinates | 1827265..1827552 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQZ87_RS08905 (NQZ87_08905) | 1822358..1824088 | - | 1731 | WP_012775361.1 | membrane protein | - |
NQZ87_RS08910 (NQZ87_08910) | 1824453..1825325 | - | 873 | WP_012775362.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
NQZ87_RS08915 (NQZ87_08915) | 1825345..1825875 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
NQZ87_RS08920 (NQZ87_08920) | 1825889..1826146 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
NQZ87_RS08925 (NQZ87_08925) | 1826148..1826408 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NQZ87_RS08930 (NQZ87_08930) | 1826484..1826939 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
NQZ87_RS08935 (NQZ87_08935) | 1826946..1827275 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQZ87_RS08940 (NQZ87_08940) | 1827265..1827552 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
NQZ87_RS08945 (NQZ87_08945) | 1827650..1828018 | - | 369 | WP_012775453.1 | hypothetical protein | - |
NQZ87_RS08950 (NQZ87_08950) | 1828011..1828580 | - | 570 | WP_012775366.1 | ribonuclease M5 | - |
NQZ87_RS08955 (NQZ87_08955) | 1828564..1829346 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
NQZ87_RS08960 (NQZ87_08960) | 1829453..1829590 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
NQZ87_RS08965 (NQZ87_08965) | 1829758..1830753 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
NQZ87_RS08970 (NQZ87_08970) | 1830773..1831585 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
NQZ87_RS08975 (NQZ87_08975) | 1831569..1831928 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1786118..1829346 | 43228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T253266 WP_012775364.1 NZ_CP102154:c1827275-1826946 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z9A6F4 |