Detailed information of TA system TA006122

Experimentally validated

Overview

TA module

• Type: II
• Classification (family/domain): yefM-yoeB (relBE)/PHD-RelE
• Location: 2405942..2406456
• Replicon: chromosome
• Accession: NC_003888
• Organism: Streptomyces coelicolor A3(2)

Toxin (Protein)

• Gene name: yoeB
• Uniprot ID: Q9Z4V8
• Locus tag: SCO2236
• Protein ID: NP_626486.1
• Coordinates: 2406202..2406456 (+)
• Length: 85 a.a.

Antitoxin (Protein)

• Gene name: yefM
• Uniprot ID: Q9Z4V7
• Locus tag: SCO2235
• Protein ID: NP_626485.1
• Coordinates: 2405942..2406205 (+)
• Length: 88 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
SCO2233	2401780..2402643	+	864	NP_626484.1	hypothetical protein	-
SCO2234	2402769..2405768	-	3000	NP_733564.1	bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase	-
SCO2235	2405942..2406205	+	264	NP_626485.1	hypothetical protein	Antitoxin
SCO2236	2406202..2406456	+	255	NP_626486.1	hypothetical protein	Toxin
SCO2237	2406519..2406965	+	447	NP_626487.1	lyase	-
SCO2238	2406988..2408829	-	1842	NP_626488.1	NAD(+) synthase (glutamine-hydrolysing)	-
SCO2239	2408840..2409466	-	627	NP_733565.1	hypothetical protein	-
SCO2240	2409463..2410131	-	669	NP_626489.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin YoeB (5-84)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (2-72)

Sequences

Toxin

Protein

• Length: 85 a.a.
• Molecular weight: 9954.26 Da
• Isoelectric Point: 9.7377

>T6122 NP_626486.1 NC_003888:2406202-2406456 [Streptomyces coelicolor A3(2)]
VRITFTSHGWEDYVHWAESDRKVTKRINRLIADIARDPFKGVGKPEPLKGDLSGYWSRRIDDTHRLVYKPTDDQLVIVQA
RYHY

Nucleotide

• Length: 255 bp

>T6122 NC_003888:2406202-2406456 [Streptomyces coelicolor A3(2)]
GTGAGGATCACTTTCACGTCCCACGGCTGGGAGGACTACGTCCACTGGGCCGAGAGCGACCGGAAGGTGACCAAGCGGAT
CAACAGACTGATCGCCGACATCGCCCGTGACCCGTTCAAGGGCGTCGGCAAGCCGGAGCCGCTCAAGGGCGACCTGTCCG
GCTACTGGTCACGGCGCATCGACGACACGCACCGTCTTGTGTACAAGCCCACCGATGACCAGCTGGTCATCGTCCAGGCG
CGCTACCACTACTGA

Antitoxin

Protein

• Length: 88 a.a.
• Molecular weight: 9692.69 Da
• Isoelectric Point: 4.4149

>AT6122 NP_626485.1 NC_003888:2405942-2406205 [Streptomyces coelicolor A3(2)]
MSITASEARQNLFPLIEQVNEDHAPVHITSRKGNAVLMSEEDFTAWTETVHLLRSPRNARRLLDSIAEAEAGDATEHDLI
DPDAERA

Nucleotide

• Length: 264 bp

>AT6122 NC_003888:2405942-2406205 [Streptomyces coelicolor A3(2)]
ATGTCCATCACCGCCAGCGAAGCCCGTCAGAACCTGTTCCCGCTGATAGAGCAGGTCAACGAGGACCACGCCCCGGTGCA
CATCACCTCCCGCAAGGGGAACGCCGTGCTCATGTCCGAGGAGGACTTCACGGCGTGGACGGAGACGGTGCATCTCCTGC
GCTCGCCGAGGAACGCCCGCCGTCTGCTCGACTCCATCGCGGAGGCCGAGGCGGGCGACGCGACTGAGCACGACCTGATC
GACCCGGACGCGGAGCGGGCGTGA

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
T130	Mycobacterium tuberculosis H37Rv	59.756	97.619	0.583
T310	Pseudomonas putida KT2440	57.143	100	0.571
T1043	Escherichia coli str. K-12 substr. MG1655	54.762	100	0.548
T4918	Actinobacillus pleuropneumoniae serovar 3 str. JL03	54.762	100	0.548
T6022	Enterococcus faecium	51.22	97.619	0.5
T728	Streptococcus pneumoniae R6	51.22	97.619	0.5
T6115	Enterococcus faecium	51.22	97.619	0.5
T6281	Streptococcus suis SC84	51.22	97.619	0.5
T6138	Lactobacillus rhamnosus Lc 705	47.561	97.619	0.464
T6143	Lactobacillus rhamnosus ATCC 8530	47.561	97.619	0.464
T6237	Lactobacillus rhamnosus Lc 705	47.561	97.619	0.464
T10020	Lacticaseibacillus rhamnosus strain 24	47.561	97.619	0.464
T10021	Lacticaseibacillus rhamnosus 51B	47.561	97.619	0.464
T10077	Agrobacterium tumefaciens str. C58	44.318	100	0.464
T2427	Staphylococcus aureus subsp. aureus NCTC 8325	44.706	100	0.452
T613	Staphylococcus aureus subsp. aureus MW2	44.706	100	0.452
T10182	Aggregatibacter actinomycetemcomitans D11S 1	47.436	93.976	0.446
T1074	Staphylococcus aureus subsp. aureus N315	43.529	100	0.44
T10072	Edwardsiella tarda EIB202	40.964	98.81	0.405

Multiple sequence alignment

Antitoxin

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
AT130	Mycobacterium tuberculosis H37Rv	70.833	82.759	0.586
AT10182	Aggregatibacter actinomycetemcomitans D11S 1	56.098	97.619	0.548
AT1043	Escherichia coli str. K-12 substr. MG1655	51.852	97.59	0.506
AT4918	Actinobacillus pleuropneumoniae serovar 3 str. JL03	50.617	97.59	0.494
AT613	Staphylococcus aureus subsp. aureus MW2	42.667	90.361	0.386
AT2427	Staphylococcus aureus subsp. aureus NCTC 8325	42.667	90.361	0.386
AT1074	Staphylococcus aureus subsp. aureus N315	42.667	90.361	0.386
AT310	Pseudomonas putida KT2440	42.308	89.655	0.379
AT10077	Agrobacterium tumefaciens str. C58	37.975	94.048	0.357
AT6138	Lactobacillus rhamnosus Lc 705	37.662	88.506	0.333
AT6237	Lactobacillus rhamnosus Lc 705	37.662	88.506	0.333
AT10020	Lacticaseibacillus rhamnosus strain 24	37.662	88.506	0.333
AT10021	Lacticaseibacillus rhamnosus 51B	37.662	88.506	0.333
AT6143	Lactobacillus rhamnosus ATCC 8530	37.662	88.506	0.333

Multiple sequence alignment

Structures

Toxin

• AlphaFold DB: Q9Z4V8

Antitoxin

• AlphaFold DB: Q9Z4V7

References

(1) Laura Sevillano et al. (2012) Identification of the first functional toxin-antitoxin system in Streptomyces. PloS One 7(3):e32977. [PubMed:22431991]

(2) Laura Sevillano et al. (2013) Stable expression plasmids for Streptomyces based on a toxin-antitoxin system. Microbial Cell Factories 12:39. [PubMed:23617558]


 experimental literature