Detailed information of TA system
Experimentally validatedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 55829..56093 | Replicon | plasmid pIFM3804 |
Accession | NC_023329 | ||
Organism | Escherichia coli |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | D616_p112058 | Protein ID | WP_001331364.1 |
Coordinates | 55941..56093 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | D616_s112002 | ||
Coordinates | 55829..55891 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HTE28_RS00320 (D616_p112062) | 51068..53359 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
HTE28_RS00325 (D616_p112061) | 53352..54422 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
HTE28_RS00330 (D616_p112060) | 54441..55649 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 55829..55891 | - | 63 | - | - | Antitoxin |
HTE28_RS00335 (D616_p112058) | 55941..56093 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
HTE28_RS00340 (D616_p112057) | 56165..56416 | - | 252 | WP_001291964.1 | hypothetical protein | - |
HTE28_RS00620 | 56914..57009 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
HTE28_RS00345 (D616_p112055) | 57074..57250 | - | 177 | WP_001054904.1 | hypothetical protein | - |
HTE28_RS00350 (D616_p112053) | 57641..57850 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
HTE28_RS00355 (D616_p112052) | 57922..58404 | - | 483 | WP_001672078.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
HTE28_RS00360 (D616_p112051) | 58645..60813 | - | 2169 | WP_021265679.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | sul2 / floR / blaCTX-M-1 | - | 1..104399 | 104399 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T6370 WP_001331364.1 NC_023329:55941-56093 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T6370 NC_023329:55941-56093 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT6370 NC_023329:c55891-55829 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|---|---|---|---|
T10208 | Escherichia coli C |
54 |
100 |
0.54 |
T10210 | Hafnia alvei |
52 |
100 |
0.52 |
T6369 | Escherichia coli K-12 |
45.455 |
89.796 |
0.408 |
T10124 | Erwinia amylovora ATCC 49946 |
39.286 |
87.5 |
0.344 |
T10039 | Escherichia coli O157:H7 str. Sakai |
33.333 |
96 |
0.32 |
T6363 | uncultured bacterium |
31.915 |
94 |
0.3 |
T6324 | Escherichia coli |
31.915 |
94 |
0.3 |
Multiple sequence alignment
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
References
(1) A K Nielsen et al. (1991) The rifampicin-inducible genes srnB from F and pnd from R483 are regulated by antisense RNAs and mediate plasmid maintenance by killing of plasmid-free segregants. Molecular Microbiology 5(8):1961-73. [PubMed:1722558]
(2) Régine Brielle et al. (2016) Linking bacterial type I toxins with their actions. Current Opinion in Microbiology 30:114-121. [PubMed:26874964]
experimental literature