Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68540..68804 | Replicon | plasmid p573-3 |
| Accession | NZ_CP102856 | ||
| Organism | Escherichia coli strain 573 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NWH85_RS25350 | Protein ID | WP_001331364.1 |
| Coordinates | 68652..68804 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 68540..68602 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWH85_RS25335 (63779) | 63779..66070 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NWH85_RS25340 (66063) | 66063..67133 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| NWH85_RS25345 (67152) | 67152..68360 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (68540) | 68540..68602 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68540) | 68540..68602 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68540) | 68540..68602 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (68540) | 68540..68602 | - | 63 | NuclAT_0 | - | Antitoxin |
| NWH85_RS25350 (68652) | 68652..68804 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| NWH85_RS25355 (68876) | 68876..69127 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NWH85_RS25360 (69489) | 69489..69721 | + | 233 | Protein_87 | hypothetical protein | - |
| NWH85_RS25365 (69786) | 69786..69962 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| NWH85_RS25370 (70354) | 70354..70563 | + | 210 | WP_039025903.1 | HEAT repeat domain-containing protein | - |
| NWH85_RS25375 (70635) | 70635..71297 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NWH85_RS25380 (71368) | 71368..73536 | - | 2169 | WP_000698354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | mph(A) / fosA3 / blaCTX-M-123 | - | 1..114525 | 114525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T254318 WP_001331364.1 NZ_CP102856:68652-68804 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT254318 NZ_CP102856:c68602-68540 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|