Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 68540..68804 Replicon plasmid p573-3
Accession NZ_CP102856
Organism Escherichia coli strain 573

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NWH85_RS25350 Protein ID WP_001331364.1
Coordinates 68652..68804 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 68540..68602 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWH85_RS25335 (63779) 63779..66070 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NWH85_RS25340 (66063) 66063..67133 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
NWH85_RS25345 (67152) 67152..68360 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (68540) 68540..68602 - 63 NuclAT_0 - Antitoxin
- (68540) 68540..68602 - 63 NuclAT_0 - Antitoxin
- (68540) 68540..68602 - 63 NuclAT_0 - Antitoxin
- (68540) 68540..68602 - 63 NuclAT_0 - Antitoxin
NWH85_RS25350 (68652) 68652..68804 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NWH85_RS25355 (68876) 68876..69127 - 252 WP_001291964.1 hypothetical protein -
NWH85_RS25360 (69489) 69489..69721 + 233 Protein_87 hypothetical protein -
NWH85_RS25365 (69786) 69786..69962 - 177 WP_001054897.1 hypothetical protein -
NWH85_RS25370 (70354) 70354..70563 + 210 WP_039025903.1 HEAT repeat domain-containing protein -
NWH85_RS25375 (70635) 70635..71297 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
NWH85_RS25380 (71368) 71368..73536 - 2169 WP_000698354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid mph(A) / fosA3 / blaCTX-M-123 - 1..114525 114525


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T254318 WP_001331364.1 NZ_CP102856:68652-68804 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT254318 NZ_CP102856:c68602-68540 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References