Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86327..86591 | Replicon | plasmid p13KWH46-2 |
| Accession | NZ_CP019252 | ||
| Organism | Escherichia coli strain 13KWH46 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | BWI84_RS26905 | Protein ID | WP_001331364.1 |
| Coordinates | 86439..86591 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 86327..86384 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI84_RS26890 | 81566..83857 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
| BWI84_RS26895 | 83850..84920 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| BWI84_RS26900 | 84939..86147 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 86327..86384 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 86327..86384 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 86327..86384 | - | 58 | NuclAT_0 | - | Antitoxin |
| - | 86327..86384 | - | 58 | NuclAT_0 | - | Antitoxin |
| BWI84_RS26905 | 86439..86591 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| BWI84_RS26910 | 86663..86914 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| BWI84_RS29195 | 87573..87749 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| BWI84_RS26915 | 88141..88350 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| BWI84_RS26920 | 88422..89072 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| BWI84_RS26925 | 89146..91314 | - | 2169 | WP_021265679.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | - | - | 1..123053 | 123053 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T71998 WP_001331364.1 NZ_CP019252:86439-86591 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T71998 NZ_CP019252:86439-86591 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT71998 NZ_CP019252:c86384-86327 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|