Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62533..62797 | Replicon | plasmid pLH50-c-B |
| Accession | NZ_CP100502 | ||
| Organism | Escherichia coli strain LH50-c | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | NLZ13_RS28155 | Protein ID | WP_001331364.1 |
| Coordinates | 62645..62797 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 62533..62590 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLZ13_RS28140 (57772) | 57772..60063 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NLZ13_RS28145 (60056) | 60056..61126 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| NLZ13_RS28150 (61145) | 61145..62353 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (62533) | 62533..62590 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (62533) | 62533..62590 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (62533) | 62533..62590 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (62533) | 62533..62590 | - | 58 | NuclAT_0 | - | Antitoxin |
| NLZ13_RS28155 (62645) | 62645..62797 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| NLZ13_RS28160 (62869) | 62869..63120 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| NLZ13_RS28165 (63482) | 63482..63714 | + | 233 | Protein_73 | hypothetical protein | - |
| NLZ13_RS28170 (63779) | 63779..63955 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| NLZ13_RS28175 (64347) | 64347..64556 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| NLZ13_RS28180 (64628) | 64628..65278 | - | 651 | WP_148374384.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NLZ13_RS28185 (65352) | 65352..67520 | - | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | dfrA1 / blaTEM-1B / sul2 | - | 1..112293 | 112293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T250696 WP_001331364.1 NZ_CP100502:62645-62797 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT250696 NZ_CP100502:c62590-62533 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|