250696

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 62533..62797 Replicon plasmid pLH50-c-B
Accession NZ_CP100502
Organism Escherichia coli strain LH50-c

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NLZ13_RS28155 Protein ID WP_001331364.1
Coordinates 62645..62797 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 62533..62590 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ13_RS28140 (57772) 57772..60063 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NLZ13_RS28145 (60056) 60056..61126 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NLZ13_RS28150 (61145) 61145..62353 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (62533) 62533..62590 - 58 NuclAT_0 - Antitoxin
- (62533) 62533..62590 - 58 NuclAT_0 - Antitoxin
- (62533) 62533..62590 - 58 NuclAT_0 - Antitoxin
- (62533) 62533..62590 - 58 NuclAT_0 - Antitoxin
NLZ13_RS28155 (62645) 62645..62797 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NLZ13_RS28160 (62869) 62869..63120 - 252 WP_001291964.1 hypothetical protein -
NLZ13_RS28165 (63482) 63482..63714 + 233 Protein_73 hypothetical protein -
NLZ13_RS28170 (63779) 63779..63955 - 177 WP_001054904.1 hypothetical protein -
NLZ13_RS28175 (64347) 64347..64556 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NLZ13_RS28180 (64628) 64628..65278 - 651 WP_148374384.1 plasmid IncI1-type surface exclusion protein ExcA -
NLZ13_RS28185 (65352) 65352..67520 - 2169 WP_021537350.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid dfrA1 / blaTEM-1B / sul2 - 1..112293 112293


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T250696 WP_001331364.1 NZ_CP100502:62645-62797 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT250696 NZ_CP100502:c62590-62533 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References