Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 57559..57823 | Replicon | plasmid pHB37-1 |
Accession | NZ_CP053081 | ||
Organism | Escherichia coli strain HB37 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | HKW69_RS25845 | Protein ID | WP_001331364.1 |
Coordinates | 57671..57823 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 57559..57621 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HKW69_RS25830 | 52798..55089 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
HKW69_RS25835 | 55082..56152 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
HKW69_RS25840 | 56171..57379 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 57559..57621 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 57559..57621 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 57559..57621 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 57559..57621 | - | 63 | NuclAT_0 | - | Antitoxin |
HKW69_RS25845 | 57671..57823 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
HKW69_RS25850 | 57895..58146 | - | 252 | WP_001291964.1 | hypothetical protein | - |
HKW69_RS25855 | 58805..58981 | - | 177 | WP_001054897.1 | hypothetical protein | - |
HKW69_RS25860 | 59373..59582 | + | 210 | WP_039025903.1 | HEAT repeat domain-containing protein | - |
HKW69_RS25865 | 59654..60316 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
HKW69_RS25870 | 60387..62555 | - | 2169 | WP_000698354.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | blaCTX-M-123 | - | 1..103328 | 103328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T155997 WP_001331364.1 NZ_CP053081:57671-57823 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T155997 NZ_CP068823:210288-210473 [Escherichia coli]
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
Antitoxin
Download Length: 63 bp
>AT155997 NZ_CP053081:c57621-57559 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|