Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 60102..60366 | Replicon | plasmid unnamed476 |
Accession | NZ_CP062869 | ||
Organism | Escherichia coli strain Res13-Lact-PEB01-20 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | IMP84_RS22710 | Protein ID | WP_001331364.1 |
Coordinates | 60214..60366 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 60102..60159 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IMP84_RS22695 | 55341..57632 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
IMP84_RS22700 | 57625..58695 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
IMP84_RS22705 | 58714..59922 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 60102..60159 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 60102..60159 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 60102..60159 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 60102..60159 | - | 58 | NuclAT_0 | - | Antitoxin |
IMP84_RS22710 | 60214..60366 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
IMP84_RS22715 | 60438..60689 | - | 252 | WP_001291964.1 | hypothetical protein | - |
IMP84_RS22720 | 61348..61524 | - | 177 | WP_001054904.1 | hypothetical protein | - |
IMP84_RS22725 | 61916..62125 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
IMP84_RS22730 | 62197..62847 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
IMP84_RS22735 | 62921..65089 | - | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | aadA5 / sul2 / blaCTX-M-1 | - | 1..112549 | 112549 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T177025 WP_001331364.1 NZ_CP062869:60214-60366 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T177025 NZ_CP083051:1828599-1828701 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT177025 NZ_CP062869:c60159-60102 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|