250845

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 65354..65618 Replicon plasmid pLH09-a-B
Accession NZ_CP100546
Organism Escherichia coli strain LH09-a

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag NLZ06_RS23455 Protein ID WP_001331364.1
Coordinates 65466..65618 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 65354..65411 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLZ06_RS23440 (60593) 60593..62884 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NLZ06_RS23445 (62877) 62877..63947 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
NLZ06_RS23450 (63966) 63966..65174 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (65354) 65354..65411 - 58 NuclAT_0 - Antitoxin
- (65354) 65354..65411 - 58 NuclAT_0 - Antitoxin
- (65354) 65354..65411 - 58 NuclAT_0 - Antitoxin
- (65354) 65354..65411 - 58 NuclAT_0 - Antitoxin
NLZ06_RS23455 (65466) 65466..65618 + 153 WP_001331364.1 Hok/Gef family protein Toxin
NLZ06_RS23460 (65690) 65690..65941 - 252 WP_001291964.1 hypothetical protein -
NLZ06_RS23465 (66303) 66303..66535 + 233 Protein_76 hypothetical protein -
NLZ06_RS23470 (66600) 66600..66776 - 177 WP_001054904.1 hypothetical protein -
NLZ06_RS23475 (67168) 67168..67377 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NLZ06_RS23480 (67449) 67449..68099 - 651 WP_148374384.1 plasmid IncI1-type surface exclusion protein ExcA -
NLZ06_RS23485 (68173) 68173..70341 - 2169 WP_021537350.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid dfrA1 / blaTEM-1B / sul2 - 1..112664 112664


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T250845 WP_001331364.1 NZ_CP100546:65466-65618 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT250845 NZ_CP100546:c65411-65354 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References