Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 581051..581309 | Replicon | chromosome |
| Accession | NC_013971 | ||
| Organism | Erwinia amylovora ATCC 49946 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | EAM_RS19805 | Protein ID | WP_231840709.1 |
| Coordinates | 581211..581309 (+) | Length | 33 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 581051..581097 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EAM_RS19540 (EAM_0488) | 576497..576640 | - | 144 | WP_004160049.1 | hypothetical protein | - |
| EAM_RS02495 (EAM_0490) | 577113..577505 | - | 393 | WP_004160048.1 | DoxX family protein | - |
| EAM_RS02500 (EAM_0491) | 577715..577996 | - | 282 | WP_004160039.1 | YqjK-like family protein | - |
| EAM_RS02505 (EAM_0492) | 577996..578388 | - | 393 | WP_004160038.1 | phage holin family protein | - |
| EAM_RS02510 (EAM_0493) | 578390..578695 | - | 306 | WP_004160037.1 | DUF883 family protein | - |
| EAM_RS02515 (EAM_0494) | 578738..579109 | - | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
| EAM_RS02520 (EAM_0495) | 579277..579669 | - | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
| EAM_RS02525 (EAM_0496) | 579666..580340 | - | 675 | WP_004160034.1 | DedA family protein | - |
| - | 581051..581097 | - | 47 | - | - | Antitoxin |
| EAM_RS19805 | 581211..581309 | + | 99 | WP_231840709.1 | Hok/Gef family protein | Toxin |
| EAM_RS02530 (EAM_0498) | 581453..582685 | - | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
| EAM_RS02535 (EAM_0499) | 582920..583900 | - | 981 | WP_013035818.1 | TerC family protein | - |
| EAM_RS02540 (EAM_0500) | 584313..586004 | + | 1692 | WP_004160025.1 | chloride channel protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3810.40 Da Isoelectric Point: 8.9407
>T10124 WP_231840709.1 NC_013971:581211-581309 [Erwinia amylovora ATCC 49946]
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 99 bp
>T10124 NC_013971:581211-581309 [Erwinia amylovora ATCC 49946]
ATATTCACATATCTGACACGAAAATCGCTCTGCGAAATTCGCTATAAGGATGGTTACAGGGAGGTGGCCGCTTTCATGGC
TTACGAATCCGGCAAGTAG
ATATTCACATATCTGACACGAAAATCGCTCTGCGAAATTCGCTATAAGGATGGTTACAGGGAGGTGGCCGCTTTCATGGC
TTACGAATCCGGCAAGTAG
Antitoxin
Download Length: 47 bp
>AT10124 NC_013971:c581097-581051 [Erwinia amylovora ATCC 49946]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T6324 | Escherichia coli |
93.75 |
100 |
0.938 |
| T6363 | uncultured bacterium |
93.75 |
100 |
0.938 |
| T10210 | Hafnia alvei |
62.069 |
90.625 |
0.563 |
| T10039 | Escherichia coli O157:H7 str. Sakai |
55.172 |
90.625 |
0.5 |
| T10209 | Escherichia coli strain ECOR24 |
57.692 |
81.25 |
0.469 |
| T10208 | Escherichia coli C |
53.846 |
81.25 |
0.437 |
| T6370 | Escherichia coli |
39.286 |
87.5 |
0.344 |
| T6369 | Escherichia coli K-12 |
35.484 |
96.875 |
0.344 |
| T10211 | E.coli NADPH-sulfite reductase flavoprotein component (cysJ) NADPH-sulfite reductase hemoprotein component (cysI) and 3' |
45.833 |
75 |
0.344 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Jingyu Peng et al. (2019) Chromosomally Encoded hok-sok Toxin-Antitoxin System in the Fire Blight Pathogen Erwinia amylovora: Identification and Functional Characterization. Applied And Environmental Microbiology 85(15):e00724-19. [PubMed:31101613]