Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 131352..131610 | Replicon | chromosome |
| Accession | NZ_LYAM01000110 | ||
| Organism | Escherichia coli strain ECOR24 | ||
| T1TAdb ID | TA07128 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | A8F87_RS08540 | Protein ID | WP_000809168.1 |
| Coordinates | 131458..131610 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 131352..131409 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A8F87_RS08520 (A8F87_07140) | 126379..127731 | + | 1353 | Protein_109 | fimbria/pilus outer membrane usher protein | - |
| A8F87_RS08525 (A8F87_07145) | 127744..128703 | + | 960 | WP_000871686.1 | hypothetical protein | - |
| A8F87_RS08530 (A8F87_07150) | 128741..129640 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| A8F87_RS08535 (A8F87_07155) | 129706..130872 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 131352..131409 | - | 58 | - | - | Antitoxin |
| A8F87_RS08540 (A8F87_07160) | 131458..131610 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| A8F87_RS08545 (A8F87_07165) | 131714..132844 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| A8F87_RS08550 (A8F87_07170) | 132933..134849 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| A8F87_RS08555 (A8F87_07175) | 135226..135630 | + | 405 | WP_000843559.1 | DUF2541 family protein | - |
| A8F87_RS08560 (A8F87_07180) | 135656..136369 | + | 714 | WP_087934625.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T10209 WP_000809168.1 NZ_LYAM01000110:131458-131610 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T10209 NZ_LYAM01000110:131458-131610 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT10209 NZ_LYAM01000110:c131409-131352 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10039 | Escherichia coli O157:H7 str. Sakai |
80 |
100 |
0.8 |
| T10124 | Erwinia amylovora ATCC 49946 |
57.692 |
81.25 |
0.469 |
| T10210 | Hafnia alvei |
39.583 |
96 |
0.38 |
| T6363 | uncultured bacterium |
38.298 |
94 |
0.36 |
| T6324 | Escherichia coli |
38.298 |
94 |
0.36 |
| T10208 | Escherichia coli C |
41.86 |
86 |
0.36 |
| T6369 | Escherichia coli K-12 |
36.957 |
93.878 |
0.347 |
Multiple sequence alignment
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) K Pedersen et al. (1999) Multiple hok genes on the chromosome of Escherichia coli. Molecular Microbiology 32(5):1090-102. [PubMed:10361310]