Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 55131..55395 | Replicon | plasmid PCN061p5 |
Accession | NZ_CP006641 | ||
Organism | Escherichia coli PCN061 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | PCN061_RS23815 | Protein ID | WP_001331364.1 |
Coordinates | 55243..55395 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 55131..55188 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCN061_RS23800 | 50370..52661 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
PCN061_RS23805 | 52654..53724 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
PCN061_RS23810 | 53743..54951 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 55131..55188 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 55131..55188 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 55131..55188 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 55131..55188 | - | 58 | NuclAT_0 | - | Antitoxin |
PCN061_RS23815 | 55243..55395 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
PCN061_RS23820 | 55467..55718 | - | 252 | WP_001291964.1 | hypothetical protein | - |
PCN061_RS29525 | 56377..56553 | - | 177 | WP_001054904.1 | hypothetical protein | - |
PCN061_RS23840 | 56945..57154 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
PCN061_RS23845 | 57226..57876 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
PCN061_RS23850 | 57950..60118 | - | 2169 | WP_021265679.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | floR | - | 1..103644 | 103644 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T45355 WP_001331364.1 NZ_CP006641:55243-55395 [Escherichia coli PCN061]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T45355 NZ_CP006641:55243-55395 [Escherichia coli PCN061]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT45355 NZ_CP006641:c55188-55131 [Escherichia coli PCN061]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|