Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 53118..53382 Replicon plasmid pEC012-3
Accession NZ_CP119580
Organism Escherichia coli strain C012_chr

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag P1J04_RS25325 Protein ID WP_001331364.1
Coordinates 53230..53382 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 53118..53180 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1J04_RS25310 (48357) 48357..50648 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
P1J04_RS25315 (50641) 50641..51711 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
P1J04_RS25320 (51730) 51730..52938 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (53118) 53118..53180 - 63 NuclAT_0 - Antitoxin
- (53118) 53118..53180 - 63 NuclAT_0 - Antitoxin
- (53118) 53118..53180 - 63 NuclAT_0 - Antitoxin
- (53118) 53118..53180 - 63 NuclAT_0 - Antitoxin
P1J04_RS25325 (53230) 53230..53382 + 153 WP_001331364.1 Hok/Gef family protein Toxin
P1J04_RS25330 (53494) 53494..53745 - 252 WP_001291964.1 hypothetical protein -
P1J04_RS25335 (54244) 54244..54339 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
P1J04_RS25340 (54404) 54404..54580 - 177 WP_001054897.1 hypothetical protein -
P1J04_RS25345 (54972) 54972..55181 + 210 WP_039025903.1 HEAT repeat domain-containing protein -
P1J04_RS25350 (55253) 55253..55915 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
P1J04_RS25355 (55986) 55986..58154 - 2169 WP_000698354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid fosA3 / blaCTX-M-123 - 1..106531 106531


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T274245 WP_001331364.1 NZ_CP119580:53230-53382 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT274245 NZ_CP119580:c53180-53118 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References