277595

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 7498..7762 Replicon plasmid unnamed2
Accession NZ_CP122662
Organism Escherichia coli strain ETEC4073

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QDY26_RS24020 Protein ID WP_001331364.1
Coordinates 7610..7762 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 7498..7555 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY26_RS24005 (2737) 2737..5028 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
QDY26_RS24010 (5021) 5021..6091 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
QDY26_RS24015 (6110) 6110..7318 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
- (7498) 7498..7555 - 58 NuclAT_0 - Antitoxin
QDY26_RS24020 (7610) 7610..7762 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QDY26_RS24025 (7834) 7834..8085 - 252 WP_001291964.1 hypothetical protein -
QDY26_RS24030 (8584) 8584..8679 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
QDY26_RS24035 (8744) 8744..8920 - 177 WP_001054904.1 hypothetical protein -
QDY26_RS24040 (9312) 9312..9521 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QDY26_RS24045 (9593) 9593..10243 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
QDY26_RS24050 (10317) 10317..12485 - 2169 WP_021537350.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid mef(C) / mph(G) - 1..102120 102120


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T277595 WP_001331364.1 NZ_CP122662:7610-7762 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT277595 NZ_CP122662:c7555-7498 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References