Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 7498..7762 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122662 | ||
| Organism | Escherichia coli strain ETEC4073 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | QDY26_RS24020 | Protein ID | WP_001331364.1 |
| Coordinates | 7610..7762 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 7498..7555 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY26_RS24005 (2737) | 2737..5028 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| QDY26_RS24010 (5021) | 5021..6091 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| QDY26_RS24015 (6110) | 6110..7318 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (7498) | 7498..7555 | - | 58 | NuclAT_0 | - | Antitoxin |
| QDY26_RS24020 (7610) | 7610..7762 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| QDY26_RS24025 (7834) | 7834..8085 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QDY26_RS24030 (8584) | 8584..8679 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| QDY26_RS24035 (8744) | 8744..8920 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| QDY26_RS24040 (9312) | 9312..9521 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QDY26_RS24045 (9593) | 9593..10243 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QDY26_RS24050 (10317) | 10317..12485 | - | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | mef(C) / mph(G) | - | 1..102120 | 102120 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T277595 WP_001331364.1 NZ_CP122662:7610-7762 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT277595 NZ_CP122662:c7555-7498 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|