Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2093789..2094088 | Replicon | chromosome |
Accession | NC_009641 | ||
Organism | Staphylococcus aureus subsp. aureus str. Newman |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | NWMN_RS15480 | Protein ID | WP_011447039.1 |
Coordinates | 2093912..2094088 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2093789..2093844 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWMN_RS10790 (NWMN_1875) | 2089120..2089380 | + | 261 | WP_001791826.1 | hypothetical protein | - |
NWMN_RS10795 (NWMN_1876) | 2089433..2089783 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
NWMN_RS10800 (NWMN_1877) | 2090468..2090917 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
NWMN_RS15775 (NWMN_1878) | 2091012..2091347 | - | 336 | Protein_2047 | SH3 domain-containing protein | - |
NWMN_RS10810 (NWMN_1880) | 2091997..2092488 | - | 492 | WP_000919350.1 | staphylokinase | - |
NWMN_RS10815 (NWMN_1881) | 2092679..2093434 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
NWMN_RS10820 (NWMN_1882) | 2093446..2093700 | - | 255 | WP_000611512.1 | phage holin | - |
NWMN_RS10825 | 2093752..2093859 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2093789..2093844 | + | 56 | - | - | Antitoxin |
NWMN_RS15480 | 2093912..2094088 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
NWMN_RS10835 (NWMN_1883) | 2094197..2094970 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
NWMN_RS10840 (NWMN_1884) | 2095391..2095765 | - | 375 | WP_000340977.1 | hypothetical protein | - |
NWMN_RS10845 (NWMN_1885) | 2095821..2096108 | - | 288 | WP_001040259.1 | hypothetical protein | - |
NWMN_RS10850 | 2096155..2096307 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 2089433..2146383 | 56950 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T22266 WP_011447039.1 NC_009641:c2094088-2093912 [Staphylococcus aureus subsp. aureus str. Newman]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T22266 NC_009641:c2094088-2093912 [Staphylococcus aureus subsp. aureus str. Newman]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT22266 NC_009641:2093789-2093844 [Staphylococcus aureus subsp. aureus str. Newman]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|