293250

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2117095..2117518 Replicon chromosome
Accession NZ_LT598688
Organism Staphylococcus aureus isolate Sa_Newman_UoM

Toxin (Protein)


Gene name higB Uniprot ID A0A5S9I4Y6
Locus tag BN8422_RS10985 Protein ID WP_001065091.1
Coordinates 2117267..2117518 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A0E0VQM8
Locus tag BN8422_RS10980 Protein ID WP_000028422.1
Coordinates 2117095..2117277 (-) Length 61 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN8422_RS10935 2112481..2114142 - 1662 WP_000625088.1 terminase large subunit -
BN8422_RS10940 2114139..2114483 - 345 WP_000402904.1 hypothetical protein -
BN8422_RS10945 2114613..2114912 - 300 WP_000988336.1 HNH endonuclease -
BN8422_RS10950 2115144..2115560 - 417 WP_000590122.1 hypothetical protein -
BN8422_RS10955 2115588..2115788 - 201 WP_000265043.1 DUF1514 family protein -
BN8422_RS10960 2115788..2115937 - 150 WP_000595265.1 transcriptional activator RinB -
BN8422_RS10965 2115934..2116320 - 387 WP_000592210.1 hypothetical protein -
BN8422_RS10970 2116317..2116523 - 207 WP_000195803.1 DUF1381 domain-containing protein -
BN8422_RS10975 2116560..2117102 - 543 WP_000185659.1 dUTP pyrophosphatase -
BN8422_RS10980 2117095..2117277 - 183 WP_000028422.1 hypothetical protein Antitoxin
BN8422_RS10985 2117267..2117518 - 252 WP_001065091.1 DUF1024 family protein Toxin
BN8422_RS15840 2117511..2117678 - 168 WP_001624242.1 hypothetical protein -
BN8422_RS10990 2117690..2117932 - 243 WP_000131366.1 hypothetical protein -
BN8422_RS10995 2117936..2118304 - 369 WP_000101274.1 hypothetical protein -
BN8422_RS11000 2118317..2118721 - 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
BN8422_RS11005 2118730..2118948 - 219 WP_000338530.1 hypothetical protein -
BN8422_RS11010 2118955..2119839 - 885 WP_000148316.1 DnaD domain protein -
BN8422_RS11015 2119869..2120339 - 471 WP_000934764.1 single-stranded DNA-binding protein -
BN8422_RS11020 2120340..2120957 - 618 WP_071621397.1 MBL fold metallo-hydrolase -
BN8422_RS11025 2121038..2121958 - 921 WP_000138472.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - scn / chp / sak / sea / hlb / groEL 2089428..2146378 56950


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9349.22 Da        Isoelectric Point: 3.9473

>T293250 WP_001065091.1 NZ_LT598688:c2117518-2117267 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE
NEH

Download         Length: 252 bp

Antitoxin


Download         Length: 61 a.a.        Molecular weight: 6741.63 Da        Isoelectric Point: 4.2658

>AT293250 WP_000028422.1 NZ_LT598688:c2117277-2117095 [Staphylococcus aureus]
MSISVGDKVFNPETNSTLEIVQLVGDIRDTHYKLSDGSIISLIDFVVKPIHLIKEEQEND

Download         Length: 183 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9I4Y6

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VQM8

References