Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2098933..2099232 | Replicon | chromosome |
Accession | NZ_CP087593 | ||
Organism | Staphylococcus aureus strain Newman NM-CQ |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | LO764_RS10615 | Protein ID | WP_011447039.1 |
Coordinates | 2099056..2099232 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2098933..2098988 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LO764_RS10575 | 2094264..2094524 | + | 261 | WP_001791826.1 | hypothetical protein | - |
LO764_RS10580 | 2094577..2094927 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
LO764_RS10585 | 2095612..2096061 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
LO764_RS10590 | 2096156..2096491 | - | 336 | Protein_2052 | SH3 domain-containing protein | - |
LO764_RS10595 | 2097141..2097632 | - | 492 | WP_000919350.1 | staphylokinase | - |
LO764_RS10600 | 2097823..2098578 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
LO764_RS10605 | 2098590..2098844 | - | 255 | WP_000611512.1 | phage holin | - |
LO764_RS10610 | 2098896..2099003 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2098925..2099064 | + | 140 | NuclAT_0 | - | - |
- | 2098925..2099064 | + | 140 | NuclAT_0 | - | - |
- | 2098925..2099064 | + | 140 | NuclAT_0 | - | - |
- | 2098925..2099064 | + | 140 | NuclAT_0 | - | - |
- | 2098933..2098988 | + | 56 | - | - | Antitoxin |
LO764_RS10615 | 2099056..2099232 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
LO764_RS10620 | 2099341..2100114 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
LO764_RS10625 | 2100535..2100909 | - | 375 | WP_000340977.1 | hypothetical protein | - |
LO764_RS10630 | 2100965..2101252 | - | 288 | WP_001040259.1 | hypothetical protein | - |
LO764_RS10635 | 2101299..2101451 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 2094577..2154552 | 59975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T225608 WP_011447039.1 NZ_CP087593:c2099232-2099056 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T225608 NZ_CP121208:723565-723795 [Arcanobacterium canis]
ATGAGCTTGCTCAAGGGCGTCATTCAACTCATCGTCCAAAACGATAAAGAATCGTTGGTGGAGCTGCGTCGTCGGCACCG
GATGCATGAGCTGAAGGGGAACTGGGCCGGAGCCAAGGAGTGCCATGTGGCCAACTTGGGCGACTGGTTGTGCGTCTGGC
AGGTCTCCGACGGTCTTGCAATCTTCCTGCGCACCGGCACCCGTGACGAAATATTCCGGTCAAACCCCTAG
ATGAGCTTGCTCAAGGGCGTCATTCAACTCATCGTCCAAAACGATAAAGAATCGTTGGTGGAGCTGCGTCGTCGGCACCG
GATGCATGAGCTGAAGGGGAACTGGGCCGGAGCCAAGGAGTGCCATGTGGCCAACTTGGGCGACTGGTTGTGCGTCTGGC
AGGTCTCCGACGGTCTTGCAATCTTCCTGCGCACCGGCACCCGTGACGAAATATTCCGGTCAAACCCCTAG
Antitoxin
Download Length: 56 bp
>AT225608 NZ_CP087593:2098933-2098988 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|