Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2093784..2094083 | Replicon | chromosome |
Accession | NZ_LT598688 | ||
Organism | Staphylococcus aureus isolate Sa_Newman_UoM |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | BN8422_RS15440 | Protein ID | WP_011447039.1 |
Coordinates | 2093907..2094083 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2093784..2093839 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN8422_RS10810 | 2089115..2089375 | + | 261 | WP_001791826.1 | hypothetical protein | - |
BN8422_RS10815 | 2089428..2089778 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
BN8422_RS10820 | 2090463..2090912 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
BN8422_RS15730 | 2091007..2091342 | - | 336 | Protein_2049 | SH3 domain-containing protein | - |
BN8422_RS10830 | 2091992..2092483 | - | 492 | WP_000919350.1 | staphylokinase | - |
BN8422_RS10835 | 2092674..2093429 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BN8422_RS10840 | 2093441..2093695 | - | 255 | WP_000611512.1 | phage holin | - |
BN8422_RS10845 | 2093747..2093854 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2093776..2093915 | + | 140 | NuclAT_0 | - | - |
- | 2093776..2093915 | + | 140 | NuclAT_0 | - | - |
- | 2093776..2093915 | + | 140 | NuclAT_0 | - | - |
- | 2093776..2093915 | + | 140 | NuclAT_0 | - | - |
- | 2093784..2093839 | + | 56 | - | - | Antitoxin |
BN8422_RS15440 | 2093907..2094083 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
BN8422_RS10850 | 2094192..2094965 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
BN8422_RS10855 | 2095386..2095760 | - | 375 | WP_000340977.1 | hypothetical protein | - |
BN8422_RS10860 | 2095816..2096103 | - | 288 | WP_001040259.1 | hypothetical protein | - |
BN8422_RS10865 | 2096150..2096302 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 2089428..2146378 | 56950 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T293247 WP_011447039.1 NZ_LT598688:c2094083-2093907 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT293247 NZ_LT598688:2093784-2093839 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|