Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 942924..943223 | Replicon | chromosome |
Accession | NZ_CP077860 | ||
Organism | Staphylococcus aureus strain AC4 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | KU521_RS04670 | Protein ID | WP_011447039.1 |
Coordinates | 943047..943223 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 942924..942979 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU521_RS04630 | 938254..938514 | + | 261 | WP_001791826.1 | hypothetical protein | - |
KU521_RS04635 | 938567..938917 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
KU521_RS04640 | 939603..940052 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
KU521_RS04645 | 940147..940482 | - | 336 | Protein_887 | SH3 domain-containing protein | - |
KU521_RS04650 | 941132..941623 | - | 492 | WP_000919350.1 | staphylokinase | - |
KU521_RS04655 | 941814..942569 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
KU521_RS04660 | 942581..942835 | - | 255 | WP_000611512.1 | phage holin | - |
KU521_RS04665 | 942887..942994 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 942916..943055 | + | 140 | NuclAT_0 | - | - |
- | 942916..943055 | + | 140 | NuclAT_0 | - | - |
- | 942916..943055 | + | 140 | NuclAT_0 | - | - |
- | 942916..943055 | + | 140 | NuclAT_0 | - | - |
- | 942924..942979 | + | 56 | - | - | Antitoxin |
KU521_RS04670 | 943047..943223 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
KU521_RS04675 | 943332..944105 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
KU521_RS04680 | 944526..944900 | - | 375 | WP_000340977.1 | hypothetical protein | - |
KU521_RS04685 | 944956..945243 | - | 288 | WP_001040259.1 | hypothetical protein | - |
KU521_RS04690 | 945290..945442 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 938567..993424 | 54857 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208223 WP_011447039.1 NZ_CP077860:c943223-943047 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208223 NZ_CP103596:183549-183656 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT208223 NZ_CP077860:942924-942979 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|