Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2022656..2022963 | Replicon | chromosome |
Accession | NZ_CP125897 | ||
Organism | Staphylococcus aureus strain CHAL4 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | QM341_RS10105 | Protein ID | WP_011447039.1 |
Coordinates | 2022787..2022963 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2022656..2022795 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QM341_RS10065 (2018223) | 2018223..2018402 | + | 180 | WP_000669791.1 | hypothetical protein | - |
QM341_RS10070 (2018713) | 2018713..2018973 | + | 261 | WP_001791826.1 | hypothetical protein | - |
QM341_RS10075 (2019026) | 2019026..2019376 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
QM341_RS10080 (2019886) | 2019886..2020221 | - | 336 | Protein_1947 | SH3 domain-containing protein | - |
QM341_RS10085 (2020872) | 2020872..2021363 | - | 492 | WP_000920038.1 | staphylokinase | - |
QM341_RS10090 (2021554) | 2021554..2022309 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
QM341_RS10095 (2022321) | 2022321..2022575 | - | 255 | WP_000611512.1 | phage holin | - |
QM341_RS10100 (2022627) | 2022627..2022734 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- (2022656) | 2022656..2022795 | + | 140 | NuclAT_0 | - | Antitoxin |
- (2022656) | 2022656..2022795 | + | 140 | NuclAT_0 | - | Antitoxin |
- (2022656) | 2022656..2022795 | + | 140 | NuclAT_0 | - | Antitoxin |
- (2022656) | 2022656..2022795 | + | 140 | NuclAT_0 | - | Antitoxin |
QM341_RS10105 (2022787) | 2022787..2022963 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
QM341_RS10110 (2023072) | 2023072..2023845 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
QM341_RS10115 (2024218) | 2024218..2024592 | - | 375 | WP_000340977.1 | hypothetical protein | - |
QM341_RS10120 (2024648) | 2024648..2024935 | - | 288 | WP_001262621.1 | hypothetical protein | - |
QM341_RS10125 (2024981) | 2024981..2025133 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / sak / sea / hlb / groEL | 2019026..2076036 | 57010 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T282434 WP_011447039.1 NZ_CP125897:c2022963-2022787 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT282434 NZ_CP125897:2022656-2022795 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|