Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) txpA-SprF3/-
Location 2081633..2081932 Replicon chromosome
Accession NZ_CP117242
Organism Staphylococcus aureus strain ATCC 14458

Toxin (Protein)


Gene name txpA Uniprot ID Q2FWU9
Locus tag PQQ25_RS10815 Protein ID WP_011447039.1
Coordinates 2081756..2081932 (-) Length 59 a.a.

Antitoxin (RNA)


Gene name SprF3
Locus tag -
Coordinates 2081633..2081688 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ25_RS10775 2076965..2077225 + 261 WP_001791826.1 hypothetical protein -
PQQ25_RS10780 2077278..2077628 - 351 WP_000702263.1 complement inhibitor SCIN-A -
PQQ25_RS10785 2078312..2078761 + 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
PQQ25_RS10790 2078856..2079191 - 336 Protein_2031 SH3 domain-containing protein -
PQQ25_RS10795 2079841..2080332 - 492 WP_000920037.1 staphylokinase -
PQQ25_RS10800 2080523..2081278 - 756 WP_000861038.1 CHAP domain-containing protein -
PQQ25_RS10805 2081290..2081544 - 255 WP_000611512.1 phage holin -
PQQ25_RS10810 2081596..2081703 + 108 WP_047212250.1 hypothetical protein -
- 2081627..2081764 + 138 NuclAT_0 - -
- 2081627..2081764 + 138 NuclAT_0 - -
- 2081627..2081764 + 138 NuclAT_0 - -
- 2081627..2081764 + 138 NuclAT_0 - -
- 2081633..2081688 + 56 - - Antitoxin
PQQ25_RS10815 2081756..2081932 - 177 WP_011447039.1 type I toxin-antitoxin system toxin PepG1 Toxin
PQQ25_RS10820 2082082..2082378 - 297 WP_000539688.1 DUF2951 domain-containing protein -
PQQ25_RS10825 2082436..2082723 - 288 WP_001040261.1 hypothetical protein -
PQQ25_RS10830 2082770..2082922 - 153 WP_001153681.1 hypothetical protein -
PQQ25_RS10835 2082912..2086697 - 3786 WP_044557000.1 phage tail spike protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - scn / chp / sak / hlb / groEL 2077278..2133891 56613
- inside Prophage - map / hlb / scn / chp / sak / hlb / groEL 2073462..2136916 63454


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Small toxic protein BsrE-like

(30-58)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6849.45 Da        Isoelectric Point: 10.6777

>T270158 WP_011447039.1 NZ_CP117242:c2081932-2081756 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Download         Length: 177 bp

Antitoxin


Download         Length: 56 bp

>AT270158 NZ_CP117242:2081633-2081688 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
PDB 7NS1

Antitoxin

Download structure file

References