Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2081633..2081932 | Replicon | chromosome |
| Accession | NZ_CP117242 | ||
| Organism | Staphylococcus aureus strain ATCC 14458 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PQQ25_RS10815 | Protein ID | WP_011447039.1 |
| Coordinates | 2081756..2081932 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2081633..2081688 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ25_RS10775 | 2076965..2077225 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| PQQ25_RS10780 | 2077278..2077628 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PQQ25_RS10785 | 2078312..2078761 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| PQQ25_RS10790 | 2078856..2079191 | - | 336 | Protein_2031 | SH3 domain-containing protein | - |
| PQQ25_RS10795 | 2079841..2080332 | - | 492 | WP_000920037.1 | staphylokinase | - |
| PQQ25_RS10800 | 2080523..2081278 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PQQ25_RS10805 | 2081290..2081544 | - | 255 | WP_000611512.1 | phage holin | - |
| PQQ25_RS10810 | 2081596..2081703 | + | 108 | WP_047212250.1 | hypothetical protein | - |
| - | 2081627..2081764 | + | 138 | NuclAT_0 | - | - |
| - | 2081627..2081764 | + | 138 | NuclAT_0 | - | - |
| - | 2081627..2081764 | + | 138 | NuclAT_0 | - | - |
| - | 2081627..2081764 | + | 138 | NuclAT_0 | - | - |
| - | 2081633..2081688 | + | 56 | - | - | Antitoxin |
| PQQ25_RS10815 | 2081756..2081932 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PQQ25_RS10820 | 2082082..2082378 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| PQQ25_RS10825 | 2082436..2082723 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| PQQ25_RS10830 | 2082770..2082922 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| PQQ25_RS10835 | 2082912..2086697 | - | 3786 | WP_044557000.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | scn / chp / sak / hlb / groEL | 2077278..2133891 | 56613 | ||
| - | inside | Prophage | - | map / hlb / scn / chp / sak / hlb / groEL | 2073462..2136916 | 63454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T270158 WP_011447039.1 NZ_CP117242:c2081932-2081756 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT270158 NZ_CP117242:2081633-2081688 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|