Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1987448..1987747 | Replicon | chromosome |
| Accession | NZ_CP078521 | ||
| Organism | Staphylococcus aureus strain ATCC 29213 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | KWH15_RS09770 | Protein ID | WP_011447039.1 |
| Coordinates | 1987571..1987747 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1987448..1987503 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWH15_RS09730 | 1982778..1983038 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| KWH15_RS09735 | 1983091..1983441 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KWH15_RS09740 | 1984127..1984576 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KWH15_RS09745 | 1984671..1985006 | - | 336 | Protein_1884 | SH3 domain-containing protein | - |
| KWH15_RS09750 | 1985656..1986147 | - | 492 | WP_000919350.1 | staphylokinase | - |
| KWH15_RS09755 | 1986338..1987093 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KWH15_RS09760 | 1987105..1987359 | - | 255 | WP_000611512.1 | phage holin | - |
| KWH15_RS09765 | 1987411..1987518 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1987440..1987579 | + | 140 | NuclAT_0 | - | - |
| - | 1987440..1987579 | + | 140 | NuclAT_0 | - | - |
| - | 1987440..1987579 | + | 140 | NuclAT_0 | - | - |
| - | 1987440..1987579 | + | 140 | NuclAT_0 | - | - |
| - | 1987448..1987503 | + | 56 | - | - | Antitoxin |
| KWH15_RS09770 | 1987571..1987747 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KWH15_RS09775 | 1987856..1988629 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
| KWH15_RS09780 | 1989050..1989424 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| KWH15_RS09785 | 1989480..1989767 | - | 288 | WP_001040259.1 | hypothetical protein | - |
| KWH15_RS09790 | 1989814..1989966 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 1983091..2034922 | 51831 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T209203 WP_011447039.1 NZ_CP078521:c1987747-1987571 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T209203 NZ_CP103964:853615-853848 [Staphylococcus hyicus]
ATGCAAATTGATCGTGTTTTTGTAGAGGGATTAGATGAGGAACAACAACGAACAGATTTAACACAACGTTTGAATCATAT
GATAGGGGTTAAAGAAGTAAGTATAGATGGTCACTTACAATGTGTAACACTTAAATATGAAACGCCAATGAATTTAAATA
CGTTAGAAAAAGAAATTTACGATGCTGGTTTTAAAGTATTACGAACAGTAAAAGGAGAGATTACGAATGAGTAA
ATGCAAATTGATCGTGTTTTTGTAGAGGGATTAGATGAGGAACAACAACGAACAGATTTAACACAACGTTTGAATCATAT
GATAGGGGTTAAAGAAGTAAGTATAGATGGTCACTTACAATGTGTAACACTTAAATATGAAACGCCAATGAATTTAAATA
CGTTAGAAAAAGAAATTTACGATGCTGGTTTTAAAGTATTACGAACAGTAAAAGGAGAGATTACGAATGAGTAA
Antitoxin
Download Length: 56 bp
>AT209203 NZ_CP078521:1987448-1987503 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|