Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 92103..92402 | Replicon | chromosome |
Accession | NZ_CP077852 | ||
Organism | Staphylococcus aureus strain N6 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | KU516_RS00510 | Protein ID | WP_011447039.1 |
Coordinates | 92226..92402 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 92103..92158 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU516_RS00470 | 87433..87693 | + | 261 | WP_001791826.1 | hypothetical protein | - |
KU516_RS00475 | 87746..88096 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
KU516_RS00480 | 88782..89231 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
KU516_RS00485 | 89326..89661 | - | 336 | Protein_93 | SH3 domain-containing protein | - |
KU516_RS00490 | 90311..90802 | - | 492 | WP_000919350.1 | staphylokinase | - |
KU516_RS00495 | 90993..91748 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
KU516_RS00500 | 91760..92014 | - | 255 | WP_000611512.1 | phage holin | - |
KU516_RS00505 | 92066..92173 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 92095..92234 | + | 140 | NuclAT_0 | - | - |
- | 92095..92234 | + | 140 | NuclAT_0 | - | - |
- | 92095..92234 | + | 140 | NuclAT_0 | - | - |
- | 92095..92234 | + | 140 | NuclAT_0 | - | - |
- | 92103..92158 | + | 56 | - | - | Antitoxin |
KU516_RS00510 | 92226..92402 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
KU516_RS00515 | 92511..93284 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
KU516_RS00520 | 93705..94079 | - | 375 | WP_000340977.1 | hypothetical protein | - |
KU516_RS00525 | 94135..94422 | - | 288 | WP_001040259.1 | hypothetical protein | - |
KU516_RS00530 | 94469..94621 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | map / hlb / scn / chp / sak / sea / hlb / groEL | 82735..139578 | 56843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208081 WP_011447039.1 NZ_CP077852:c92402-92226 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208081 NZ_CP103562:c4685922-4685749 [Escherichia coli O25b:H4-ST131]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTTTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTTTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 56 bp
>AT208081 NZ_CP077852:92103-92158 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|