Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1742169..1742468 | Replicon | chromosome |
Accession | NZ_CP041010 | ||
Organism | Staphylococcus aureus strain FDAARGOS_766 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FIU19_RS09335 | Protein ID | WP_011447039.1 |
Coordinates | 1742292..1742468 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1742169..1742224 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FIU19_RS09290 | 1737433..1738605 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
FIU19_RS09300 | 1738848..1739297 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FIU19_RS09305 | 1739392..1739727 | - | 336 | Protein_1699 | SH3 domain-containing protein | - |
FIU19_RS09315 | 1740377..1740868 | - | 492 | WP_000919350.1 | staphylokinase | - |
FIU19_RS09320 | 1741059..1741814 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FIU19_RS09325 | 1741826..1742080 | - | 255 | WP_000611512.1 | phage holin | - |
FIU19_RS09330 | 1742132..1742239 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1742161..1742300 | + | 140 | NuclAT_0 | - | - |
- | 1742161..1742300 | + | 140 | NuclAT_0 | - | - |
- | 1742161..1742300 | + | 140 | NuclAT_0 | - | - |
- | 1742161..1742300 | + | 140 | NuclAT_0 | - | - |
- | 1742169..1742224 | + | 56 | - | - | Antitoxin |
FIU19_RS09335 | 1742292..1742468 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FIU19_RS09340 | 1742577..1743350 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
FIU19_RS09350 | 1743771..1744145 | - | 375 | WP_000340977.1 | hypothetical protein | - |
FIU19_RS09355 | 1744201..1744488 | - | 288 | WP_001040259.1 | hypothetical protein | - |
FIU19_RS09360 | 1744535..1744687 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb | 1736480..1786579 | 50099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T127394 WP_011447039.1 NZ_CP041010:c1742468-1742292 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T127394 NZ_CP041010:c1742468-1742292 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT127394 NZ_CP041010:1742169-1742224 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|