Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2005250..2005549 | Replicon | chromosome |
Accession | NZ_AP019712 | ||
Organism | Staphylococcus aureus strain Tokyo12480 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | GOZ34_RS09760 | Protein ID | WP_011447039.1 |
Coordinates | 2005373..2005549 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2005250..2005305 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ34_RS09720 | 2000581..2000841 | + | 261 | WP_001791826.1 | hypothetical protein | - |
GOZ34_RS09725 | 2000894..2001244 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
GOZ34_RS09730 | 2001929..2002378 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
GOZ34_RS09735 | 2002473..2002808 | - | 336 | Protein_1871 | SH3 domain-containing protein | - |
GOZ34_RS09740 | 2003458..2003949 | - | 492 | WP_000919350.1 | staphylokinase | - |
GOZ34_RS09745 | 2004140..2004895 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
GOZ34_RS09750 | 2004907..2005161 | - | 255 | WP_000611512.1 | phage holin | - |
GOZ34_RS09755 | 2005213..2005320 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2005242..2005381 | + | 140 | NuclAT_0 | - | - |
- | 2005242..2005381 | + | 140 | NuclAT_0 | - | - |
- | 2005242..2005381 | + | 140 | NuclAT_0 | - | - |
- | 2005242..2005381 | + | 140 | NuclAT_0 | - | - |
- | 2005250..2005305 | + | 56 | - | - | Antitoxin |
GOZ34_RS09760 | 2005373..2005549 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
GOZ34_RS09765 | 2005658..2006431 | - | 774 | WP_000750406.1 | staphylococcal enterotoxin type A | - |
GOZ34_RS09770 | 2006852..2007226 | - | 375 | WP_000340977.1 | hypothetical protein | - |
GOZ34_RS09775 | 2007282..2007569 | - | 288 | WP_001040259.1 | hypothetical protein | - |
GOZ34_RS09780 | 2007616..2007768 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / sea / hlb / groEL | 2000894..2055348 | 54454 | ||
- | flank | IS/Tn | - | - | 2008661..2008942 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T32920 WP_011447039.1 NZ_AP019712:c2005549-2005373 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T32920 NZ_AP019712:c2005549-2005373 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT32920 NZ_AP019712:2005250-2005305 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|