Detailed information
Overview
| Name | comX/sigX | Type | Regulator |
| Locus tag | SMU_RS09085 | Genome accession | NC_004350 |
| Coordinates | 1872021..1872503 (-) | Length | 160 a.a. |
| NCBI ID | WP_002263585.1 | Uniprot ID | A0AAX1K1V7 |
| Organism | Streptococcus mutans UA159 | ||
| Function | activate transcription of late competence genes Competence regulation |
||
Function
The ComS pre-peptide is exported and processed via an unknown mechanism into XIP. XIP is re-imported via oligopeptide permease (Opp) and binds ComR. The ComR/XIP complex binds upstream of comS and sigX at PComR-box sites. The alternative sigma factor, SigX, facilitates RNA polymerase (RNAP) binding at Pcin-box sites. Genes regulated by SigX include the DNA-uptake and transformasome machinery.
Genomic Context
Location: 1867021..1877503
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS09065 (SMU.1993) | - | 1868430..1869242 (-) | 813 | WP_002263429.1 | metal ABC transporter permease | - |
| SMU_RS09070 (SMU.1994) | - | 1869232..1869942 (-) | 711 | WP_002263428.1 | metal ABC transporter ATP-binding protein | - |
| SMU_RS09075 (SMU.1995c) | - | 1869945..1870391 (-) | 447 | WP_002263427.1 | zinc-dependent MarR family transcriptional regulator | - |
| SMU_RS09080 (SMU.1996) | ispE | 1871026..1871874 (-) | 849 | WP_002352368.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| SMU_RS09085 (SMU.1997) | comX/sigX | 1872021..1872503 (-) | 483 | WP_002263585.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comX/sigX | late competence genes | positive effect |
| comX/sigX | late competence genes | positive effect |
| scnR | comX/sigX | positive effect |
| hdrR | comX/sigX | positive effect |
| mecA | comX/sigX | negative effect |
| clpC | comX/sigX | negative effect |
| comR | comX/sigX | positive effect |
| clpP | comX/sigX | negative effect |
| XrpA | comX/sigX | negative effect |
| scnK | comX/sigX | positive effect |
| comS | comX/sigX | positive effect |
| comD/blpH | comX/sigX | positive effect |
| vicK | comX/sigX | negative effect |
| comE/blpR | comX/sigX | positive effect |
| scnC | comX/sigX | positive effect |
| brsR | comX/sigX | positive effect |
| cipB | comX/sigX | positive effect |
| vicR | comX/sigX | negative effect |
| comC/blpC | comX/sigX | positive effect |
| hdrR | comR | positive effect |
| comR | comS | positive effect |
| cipB | comR | positive effect |
| XrpA | comR | negative effect |
| hdrM | hdrR | negative effect |
| comS | comS | positive effect |
| oppD | comS | positive effect |
| cipB | comS | positive effect |
| XrpA | comS | negative effect |
| comD/blpH | comE/blpR | positive effect |
| comE/blpR | comD/blpH | positive effect |
| comE/blpR | comC/blpC | positive effect |
| comE/blpR | comA/nlmT | positive effect |
| comE/blpR | comE/blpR | positive effect |
| comE/blpR | comB/nlmE | positive effect |
| vicR | comE/blpR | negative effect |
| vicK | comE/blpR | negative effect |
| vicR | comD/blpH | negative effect |
| vicR | comC/blpC | negative effect |
| vicK | comD/blpH | negative effect |
| vicK | comC/blpC | negative effect |
| comC/blpC | comD/blpH | positive effect |
| comA/nlmT | comC/blpC | positive effect |
| comB/nlmE | comC/blpC | positive effect |
| ciaH | comC/blpC | positive effect |
| sepM | comC/blpC | positive effect |
| brsM | brsR | negative effect |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 19605.49 Da Isoelectric Point: 6.4997
>NTDB_id=44 SMU_RS09085 WP_002263585.1 1872021..1872503(-) (comX/sigX) [Streptococcus mutans UA159]
MEEDFEIVFNKVKPIVWKLSRYYFIKMWTREDWQQEGMLILHQLLREHPELEEDDTKLYIYFKTRFSNYIKDVLRQQESQ
KRRFNRMSYEEVGEIEHCLSSGGMQLDEYILFRDSLLAYKQGLSTEKQELFERLVAGEHFLGRQSMLKDLRKKLSDFKEK
MEEDFEIVFNKVKPIVWKLSRYYFIKMWTREDWQQEGMLILHQLLREHPELEEDDTKLYIYFKTRFSNYIKDVLRQQESQ
KRRFNRMSYEEVGEIEHCLSSGGMQLDEYILFRDSLLAYKQGLSTEKQELFERLVAGEHFLGRQSMLKDLRKKLSDFKEK
Nucleotide
Download Length: 483 bp
>NTDB_id=44 SMU_RS09085 WP_002263585.1 1872021..1872503(-) (comX/sigX) [Streptococcus mutans UA159]
ATGGAAGAAGATTTTGAAATTGTTTTTAATAAGGTTAAGCCAATTGTATGGAAATTAAGCCGTTATTACTTTATTAAAAT
GTGGACTCGTGAAGATTGGCAACAAGAGGGAATGTTGATTTTGCACCAATTATTAAGGGAACATCCAGAATTAGAAGAGG
ATGATACAAAATTGTATATCTATTTTAAGACACGTTTTTCTAATTACATTAAAGATGTTTTGCGTCAGCAAGAAAGTCAG
AAACGTCGTTTTAATAGAATGTCTTATGAAGAAGTCGGTGAGATTGAACACTGTTTGTCAAGTGGCGGTATGCAATTGGA
TGAATATATTTTATTTCGTGATAGTTTGCTTGCATATAAACAAGGTCTGAGTACTGAAAAGCAAGAGCTGTTTGAGCGCT
TGGTAGCAGGAGAGCACTTTTTGGGAAGGCAAAGTATGCTGAAAGATTTACGTAAAAAATTAAGTGATTTTAAGGAAAAA
TAG
ATGGAAGAAGATTTTGAAATTGTTTTTAATAAGGTTAAGCCAATTGTATGGAAATTAAGCCGTTATTACTTTATTAAAAT
GTGGACTCGTGAAGATTGGCAACAAGAGGGAATGTTGATTTTGCACCAATTATTAAGGGAACATCCAGAATTAGAAGAGG
ATGATACAAAATTGTATATCTATTTTAAGACACGTTTTTCTAATTACATTAAAGATGTTTTGCGTCAGCAAGAAAGTCAG
AAACGTCGTTTTAATAGAATGTCTTATGAAGAAGTCGGTGAGATTGAACACTGTTTGTCAAGTGGCGGTATGCAATTGGA
TGAATATATTTTATTTCGTGATAGTTTGCTTGCATATAAACAAGGTCTGAGTACTGAAAAGCAAGAGCTGTTTGAGCGCT
TGGTAGCAGGAGAGCACTTTTTGGGAAGGCAAAGTATGCTGAAAGATTTACGTAAAAAATTAAGTGATTTTAAGGAAAAA
TAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
Multiple sequence alignment
References
| [1] | Antonio Pedro Ricomini Filho et al. (2019) Conserved Pheromone Production, Response and Degradation by Streptococcus mutans. Frontiers in Microbiology 10:2140. [PMID: 31572344] |
| [2] | Simon A M Underhill et al. (2018) Intracellular Signaling by the comRS System in Streptococcus mutans Genetic Competence. MSphere 3(5):e00444-18. [PMID: 30381353] |
| [3] | Iwona B Wenderska et al. (2017) Transcriptional Profiling of the Oral Pathogen Streptococcus mutans in Response to Competence Signaling Peptide XIP. MSystems 2(1):e00102-16. [PMID: 28066817] |
| [4] | Justin Kaspar et al. (2017) Intercellular Communication via the comX-Inducing Peptide (XIP) of Streptococcus mutans. Journal of Bacteriology 199(21):e00404-17. [PMID: 28808131] |
| [5] | R Khan et al. (2016) Comprehensive Transcriptome Profiles of Streptococcus mutans UA159 Map Core Streptococcal Competence Genes. MSystems 1(2):e00038-15. [PMID: 27822519] |
| [6] | Michael Reck et al. (2015) The Alternative Sigma Factor SigX Controls Bacteriocin Synthesis and Competence, the Two Quorum Sensing Regulated Traits in Streptococcus mutans. PLoS Genetics 11(7):e1005353. [PMID: 26158727] |
| [7] | Minjun Son et al. (2015) Bidirectional signaling in the competence regulatory pathway of Streptococcus mutans. FEMS Microbiology Letters 362(19):fnv159. [PMID: 26363019] |
| [8] | Gaofeng Dong et al. (2014) Regulated proteolysis of the alternative sigma factor SigX in Streptococcus mutans: implication in the escape from competence. BMC Microbiology 14:183. [PMID: 25005884] |
| [9] | Kunal Desai et al. (2012) Development of competence for genetic transformation of Streptococcus mutans in a chemically defined medium. Journal of Bacteriology 194(15):3774-80. [PMID: 22609913] |
| [10] | Minjun Son et al. (2012) Microfluidic study of competence regulation in Streptococcus mutans: environmental inputs modulate bimodal and unimodal expression of comX. Molecular Microbiology 86(2):258-72. [PMID: 22845615] |
| [11] | Iwona B Wenderska et al. (2012) A novel function for the competence inducing peptide, XIP, as a cell death effector of Streptococcus mutans. FEMS Microbiology Letters 336(2):104-12. [PMID: 22900705] |
| [12] | Lauren Mashburn-Warren et al. (2010) A novel double-tryptophan peptide pheromone controls competence in Streptococcus spp. via an Rgg regulator. Molecular Microbiology 78(3):589-606. [PMID: 20969646] |
| [13] | Julie A Perry et al. (2009) Peptide alarmone signalling triggers an auto-active bacteriocin necessary for genetic competence. Molecular Microbiology 72(4):905-17. [PMID: 19400789] |