Detailed information    

experimental Experimentally validated

Overview


Name   hdrR   Type   Regulator
Locus tag   SMU_RS08500 Genome accession   NC_004350
Coordinates   1753506..1753862 (+) Length   118 a.a.
NCBI ID   WP_002262669.1    Uniprot ID   -
Organism   Streptococcus mutans UA159     
Function   activate competence development   
Competence regulation

Function


The primary function of the HdrRM system is to regulate the late competence genes together with various bacteriocins. This occurs independently of the ComCDE system, even though both systems regulate nearly identical genes. Expression of comR, comX and late competence genes is strongly stimulated either when mutating the HdrM membranebound protein, or when HdrR is overexpressed.


Genomic Context


Location: 1748506..1758862
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMU_RS08485 - 1750858..1751079 (+) 222 WP_019313410.1 hypothetical protein -
  SMU_RS08490 (SMU.1852) - 1751479..1752423 (+) 945 WP_002262667.1 magnesium transporter CorA family protein -
  SMU_RS08495 (SMU.1853) - 1752705..1753367 (+) 663 WP_002262668.1 DUF1129 domain-containing protein -
  SMU_RS08500 (SMU.1854) hdrR 1753506..1753862 (+) 357 WP_002262669.1 LytTR family transcriptional regulator HdrR Regulator
  SMU_RS08505 (SMU.1855) hdrM 1753859..1754545 (+) 687 WP_002262670.1 hdrR negative regulator HdrM Regulator
  SMU_RS08510 (SMU.1856c) - 1754553..1755272 (-) 720 WP_002262671.1 TraX family protein -
  SMU_RS08515 (SMU.1858) rpsR 1755591..1755830 (-) 240 WP_000068664.1 30S ribosomal protein S18 -
  SMU_RS08520 (SMU.1859) - 1755859..1756353 (-) 495 WP_002261867.1 single-stranded DNA-binding protein -
  SMU_RS08525 (SMU.1860) rpsF 1756371..1756661 (-) 291 WP_002261866.1 30S ribosomal protein S6 -
  SMU_RS08530 (SMU.1861c) - 1756817..1757062 (-) 246 WP_002263367.1 hypothetical protein -
  SMU_RS08535 (SMU.1862) - 1757367..1757570 (+) 204 WP_002263366.1 hypothetical protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  hdrR comX/sigX positive effect
  comX/sigX late competence genes positive effect
  comX/sigX late competence genes positive effect
  scnR comX/sigX positive effect
  hdrR comR positive effect
  hdrM hdrR negative effect
  mecA comX/sigX negative effect
  clpC comX/sigX negative effect
  comR comX/sigX positive effect
  comR comS positive effect
  cipB comR positive effect
  XrpA comR negative effect
  clpP comX/sigX negative effect
  XrpA comX/sigX negative effect
  XrpA comS negative effect
  scnK comX/sigX positive effect
  comS comX/sigX positive effect
  comS comS positive effect
  oppD comS positive effect
  cipB comS positive effect
  comD/blpH comX/sigX positive effect
  comD/blpH comE/blpR positive effect
  vicR comD/blpH negative effect
  comE/blpR comD/blpH positive effect
  vicK comD/blpH negative effect
  comC/blpC comD/blpH positive effect
  vicK comX/sigX negative effect
  vicK comC/blpC negative effect
  vicK comE/blpR negative effect
  comE/blpR comX/sigX positive effect
  comE/blpR comC/blpC positive effect
  comE/blpR comA/nlmT positive effect
  comE/blpR comE/blpR positive effect
  comE/blpR comB/nlmE positive effect
  vicR comE/blpR negative effect
  scnC comX/sigX positive effect
  brsR comX/sigX positive effect
  brsM brsR negative effect
  cipB comX/sigX positive effect
  vicR comX/sigX negative effect
  vicR comC/blpC negative effect
  comC/blpC comX/sigX positive effect
  comA/nlmT comC/blpC positive effect
  comB/nlmE comC/blpC positive effect
  ciaH comC/blpC positive effect
  sepM comC/blpC positive effect

Sequence


Protein


Download         Length: 118 a.a.        Molecular weight: 14134.45 Da        Isoelectric Point: 10.3603

>NTDB_id=364 SMU_RS08500 WP_002262669.1 1753506..1753862(+) (hdrR) [Streptococcus mutans UA159]
MEIHLNPKHQSVEVFLEKEIFFLNIRDILFIEINNRKTYVHTNDKVYKSHLLLRDFKEILPDYFQQIGKSQIANSLEISA
INKSFSSTPKISFRHSSKTTWVSRKYYKELLMKKRSLL

Nucleotide


Download         Length: 357 bp        

>NTDB_id=364 SMU_RS08500 WP_002262669.1 1753506..1753862(+) (hdrR) [Streptococcus mutans UA159]
ATGGAGATTCACTTAAATCCTAAACATCAGTCAGTAGAGGTCTTTTTAGAAAAGGAAATTTTCTTTTTAAATATTAGAGA
TATTCTCTTTATTGAAATCAACAATCGGAAAACTTATGTTCATACTAATGATAAAGTTTACAAAAGCCATTTGCTTCTGC
GCGATTTCAAAGAAATTTTACCTGATTATTTTCAGCAAATTGGCAAGAGTCAGATTGCCAATAGCCTTGAAATTTCTGCC
ATCAATAAGTCTTTCTCCTCTACCCCCAAAATTAGTTTTAGACATTCATCCAAAACAACTTGGGTATCTCGTAAATACTA
CAAAGAATTACTTATGAAAAAAAGGAGTTTACTATGA

Domains


Predicted by InterProScan.

(19-111)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Zhoujie Xie et al. (2020) Regulatory control of the Streptococcus mutans HdrRM LytTR Regulatory System functions via a membrane sequestration mechanism. Molecular Microbiology 114(4):681-693. [PMID: 32706915]
[2] Toshinori Okinaga et al. (2010) The hdrRM operon of Streptococcus mutans encodes a novel regulatory system for coordinated competence development and bacteriocin production. Journal of Bacteriology 192(7):1844-52. [PMID: 20118256]
[3] T Okinaga et al. (2010) Examination of the hdrRM regulon yields insight into the competence system of Streptococcus mutans. Molecular Oral Microbiology 25(3):165-77. [PMID: 20536745]
[4] Justin Merritt et al. (2007) Genetic characterization of the hdrRM operon: a novel high-cell-density-responsive regulator in Streptococcus mutans. Microbiology (Reading, England) 153(Pt 8):2765-2773. [PMID: 17660440]