Detailed information
Overview
| Name | hdrR | Type | Regulator |
| Locus tag | SMU_RS08500 | Genome accession | NC_004350 |
| Coordinates | 1753506..1753862 (+) | Length | 118 a.a. |
| NCBI ID | WP_002262669.1 | Uniprot ID | - |
| Organism | Streptococcus mutans UA159 | ||
| Function | activate competence development Competence regulation |
||
Function
The primary function of the HdrRM system is to regulate the late competence genes together with various bacteriocins. This occurs independently of the ComCDE system, even though both systems regulate nearly identical genes. Expression of comR, comX and late competence genes is strongly stimulated either when mutating the HdrM membranebound protein, or when HdrR is overexpressed.
Genomic Context
Location: 1748506..1758862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS08485 | - | 1750858..1751079 (+) | 222 | WP_019313410.1 | hypothetical protein | - |
| SMU_RS08490 (SMU.1852) | - | 1751479..1752423 (+) | 945 | WP_002262667.1 | magnesium transporter CorA family protein | - |
| SMU_RS08495 (SMU.1853) | - | 1752705..1753367 (+) | 663 | WP_002262668.1 | DUF1129 domain-containing protein | - |
| SMU_RS08500 (SMU.1854) | hdrR | 1753506..1753862 (+) | 357 | WP_002262669.1 | LytTR family transcriptional regulator HdrR | Regulator |
| SMU_RS08505 (SMU.1855) | hdrM | 1753859..1754545 (+) | 687 | WP_002262670.1 | hdrR negative regulator HdrM | Regulator |
| SMU_RS08510 (SMU.1856c) | - | 1754553..1755272 (-) | 720 | WP_002262671.1 | TraX family protein | - |
| SMU_RS08515 (SMU.1858) | rpsR | 1755591..1755830 (-) | 240 | WP_000068664.1 | 30S ribosomal protein S18 | - |
| SMU_RS08520 (SMU.1859) | - | 1755859..1756353 (-) | 495 | WP_002261867.1 | single-stranded DNA-binding protein | - |
| SMU_RS08525 (SMU.1860) | rpsF | 1756371..1756661 (-) | 291 | WP_002261866.1 | 30S ribosomal protein S6 | - |
| SMU_RS08530 (SMU.1861c) | - | 1756817..1757062 (-) | 246 | WP_002263367.1 | hypothetical protein | - |
| SMU_RS08535 (SMU.1862) | - | 1757367..1757570 (+) | 204 | WP_002263366.1 | hypothetical protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| hdrR | comX/sigX | positive effect |
| comX/sigX | late competence genes | positive effect |
| comX/sigX | late competence genes | positive effect |
| scnR | comX/sigX | positive effect |
| hdrR | comR | positive effect |
| hdrM | hdrR | negative effect |
| mecA | comX/sigX | negative effect |
| clpC | comX/sigX | negative effect |
| comR | comX/sigX | positive effect |
| comR | comS | positive effect |
| cipB | comR | positive effect |
| XrpA | comR | negative effect |
| clpP | comX/sigX | negative effect |
| XrpA | comX/sigX | negative effect |
| XrpA | comS | negative effect |
| scnK | comX/sigX | positive effect |
| comS | comX/sigX | positive effect |
| comS | comS | positive effect |
| oppD | comS | positive effect |
| cipB | comS | positive effect |
| comD/blpH | comX/sigX | positive effect |
| comD/blpH | comE/blpR | positive effect |
| vicR | comD/blpH | negative effect |
| comE/blpR | comD/blpH | positive effect |
| vicK | comD/blpH | negative effect |
| comC/blpC | comD/blpH | positive effect |
| vicK | comX/sigX | negative effect |
| vicK | comC/blpC | negative effect |
| vicK | comE/blpR | negative effect |
| comE/blpR | comX/sigX | positive effect |
| comE/blpR | comC/blpC | positive effect |
| comE/blpR | comA/nlmT | positive effect |
| comE/blpR | comE/blpR | positive effect |
| comE/blpR | comB/nlmE | positive effect |
| vicR | comE/blpR | negative effect |
| scnC | comX/sigX | positive effect |
| brsR | comX/sigX | positive effect |
| brsM | brsR | negative effect |
| cipB | comX/sigX | positive effect |
| vicR | comX/sigX | negative effect |
| vicR | comC/blpC | negative effect |
| comC/blpC | comX/sigX | positive effect |
| comA/nlmT | comC/blpC | positive effect |
| comB/nlmE | comC/blpC | positive effect |
| ciaH | comC/blpC | positive effect |
| sepM | comC/blpC | positive effect |
Sequence
Protein
Download Length: 118 a.a. Molecular weight: 14134.45 Da Isoelectric Point: 10.3603
>NTDB_id=364 SMU_RS08500 WP_002262669.1 1753506..1753862(+) (hdrR) [Streptococcus mutans UA159]
MEIHLNPKHQSVEVFLEKEIFFLNIRDILFIEINNRKTYVHTNDKVYKSHLLLRDFKEILPDYFQQIGKSQIANSLEISA
INKSFSSTPKISFRHSSKTTWVSRKYYKELLMKKRSLL
MEIHLNPKHQSVEVFLEKEIFFLNIRDILFIEINNRKTYVHTNDKVYKSHLLLRDFKEILPDYFQQIGKSQIANSLEISA
INKSFSSTPKISFRHSSKTTWVSRKYYKELLMKKRSLL
Nucleotide
Download Length: 357 bp
>NTDB_id=364 SMU_RS08500 WP_002262669.1 1753506..1753862(+) (hdrR) [Streptococcus mutans UA159]
ATGGAGATTCACTTAAATCCTAAACATCAGTCAGTAGAGGTCTTTTTAGAAAAGGAAATTTTCTTTTTAAATATTAGAGA
TATTCTCTTTATTGAAATCAACAATCGGAAAACTTATGTTCATACTAATGATAAAGTTTACAAAAGCCATTTGCTTCTGC
GCGATTTCAAAGAAATTTTACCTGATTATTTTCAGCAAATTGGCAAGAGTCAGATTGCCAATAGCCTTGAAATTTCTGCC
ATCAATAAGTCTTTCTCCTCTACCCCCAAAATTAGTTTTAGACATTCATCCAAAACAACTTGGGTATCTCGTAAATACTA
CAAAGAATTACTTATGAAAAAAAGGAGTTTACTATGA
ATGGAGATTCACTTAAATCCTAAACATCAGTCAGTAGAGGTCTTTTTAGAAAAGGAAATTTTCTTTTTAAATATTAGAGA
TATTCTCTTTATTGAAATCAACAATCGGAAAACTTATGTTCATACTAATGATAAAGTTTACAAAAGCCATTTGCTTCTGC
GCGATTTCAAAGAAATTTTACCTGATTATTTTCAGCAAATTGGCAAGAGTCAGATTGCCAATAGCCTTGAAATTTCTGCC
ATCAATAAGTCTTTCTCCTCTACCCCCAAAATTAGTTTTAGACATTCATCCAAAACAACTTGGGTATCTCGTAAATACTA
CAAAGAATTACTTATGAAAAAAAGGAGTTTACTATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Zhoujie Xie et al. (2020) Regulatory control of the Streptococcus mutans HdrRM LytTR Regulatory System functions via a membrane sequestration mechanism. Molecular Microbiology 114(4):681-693. [PMID: 32706915] |
| [2] | Toshinori Okinaga et al. (2010) The hdrRM operon of Streptococcus mutans encodes a novel regulatory system for coordinated competence development and bacteriocin production. Journal of Bacteriology 192(7):1844-52. [PMID: 20118256] |
| [3] | T Okinaga et al. (2010) Examination of the hdrRM regulon yields insight into the competence system of Streptococcus mutans. Molecular Oral Microbiology 25(3):165-77. [PMID: 20536745] |
| [4] | Justin Merritt et al. (2007) Genetic characterization of the hdrRM operon: a novel high-cell-density-responsive regulator in Streptococcus mutans. Microbiology (Reading, England) 153(Pt 8):2765-2773. [PMID: 17660440] |