Detailed information
Overview
| Name | comR | Type | Regulator |
| Locus tag | SMU_RS00375 | Genome accession | NC_004350 |
| Coordinates | 61631..62545 (+) | Length | 304 a.a. |
| NCBI ID | WP_002263400.1 | Uniprot ID | Q8DWI6 |
| Organism | Streptococcus mutans UA159 | ||
| Function | activate transcription of comX Competence regulation |
||
Function
The ComS pre-peptide is exported and processed via an unknown mechanism into XIP. XIP is re-imported via oligopeptide permease (Opp) and binds ComR. The ComR/XIP complex binds upstream of comS and sigX at PComR-box sites. The alternative sigma factor, SigX, facilitates RNA polymerase (RNAP) binding at Pcin-box sites. Genes regulated by SigX include the DNA-uptake and transformasome machinery.
Genomic Context
Location: 56631..67545
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS10165 | - | 57029..57123 (+) | 95 | Protein_47 | phosphoribosylaminoimidazole carboxylase | - |
| SMU_RS00350 (SMU.55) | - | 57125..57388 (+) | 264 | WP_002263395.1 | hypothetical protein | - |
| SMU_RS00355 | - | 57408..57633 (+) | 226 | Protein_49 | phosphoribosylaminoimidazole carboxylase | - |
| SMU_RS00360 (SMU.58) | - | 57639..58934 (+) | 1296 | WP_002263397.1 | hypothetical protein | - |
| SMU_RS00365 (SMU.59) | purB | 59244..60542 (+) | 1299 | WP_002263398.1 | adenylosuccinate lyase | - |
| SMU_RS00370 (SMU.60) | - | 60562..61248 (+) | 687 | WP_002263399.1 | DNA alkylation repair protein | - |
| SMU_RS00375 (SMU.61) | comR | 61631..62545 (+) | 915 | WP_002263400.1 | helix-turn-helix domain-containing protein | Regulator |
| SMU_RS00380 (SMU.63c) | - | 63079..64920 (-) | 1842 | WP_002263401.1 | carbohydrate-binding domain-containing protein | - |
| SMU_RS00385 (SMU.64) | ruvB | 65256..66251 (+) | 996 | WP_002263402.1 | Holliday junction branch migration DNA helicase RuvB | Machinery gene |
| SMU_RS00390 (SMU.65) | - | 66289..66714 (+) | 426 | WP_002263403.1 | low molecular weight protein-tyrosine-phosphatase | - |
| SMU_RS00395 (SMU.66) | - | 66779..67162 (+) | 384 | WP_011074470.1 | membrane protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| comR | comS | positive effect |
| comS | comS | positive effect |
| comS | comX/sigX | positive effect |
| oppD | comS | positive effect |
| cipB | comS | positive effect |
| XrpA | comS | negative effect |
| comX/sigX | late competence genes | positive effect |
| scnR | comX/sigX | positive effect |
| hdrR | comX/sigX | positive effect |
| mecA | comX/sigX | negative effect |
| clpC | comX/sigX | negative effect |
| comR | comX/sigX | positive effect |
| clpP | comX/sigX | negative effect |
| XrpA | comX/sigX | negative effect |
| scnK | comX/sigX | positive effect |
| comD/blpH | comX/sigX | positive effect |
| vicK | comX/sigX | negative effect |
| comE/blpR | comX/sigX | positive effect |
| scnC | comX/sigX | positive effect |
| brsR | comX/sigX | positive effect |
| cipB | comX/sigX | positive effect |
| vicR | comX/sigX | negative effect |
| comC/blpC | comX/sigX | positive effect |
| cipB | comR | positive effect |
| hdrR | comR | positive effect |
| XrpA | comR | negative effect |
| comX/sigX | late competence genes | positive effect |
| hdrM | hdrR | negative effect |
| comD/blpH | comE/blpR | positive effect |
| vicR | comD/blpH | negative effect |
| comE/blpR | comD/blpH | positive effect |
| vicK | comD/blpH | negative effect |
| comC/blpC | comD/blpH | positive effect |
| vicK | comC/blpC | negative effect |
| vicK | comE/blpR | negative effect |
| comE/blpR | comC/blpC | positive effect |
| comE/blpR | comA/nlmT | positive effect |
| comE/blpR | comE/blpR | positive effect |
| comE/blpR | comB/nlmE | positive effect |
| vicR | comE/blpR | negative effect |
| brsM | brsR | negative effect |
| vicR | comC/blpC | negative effect |
| comA/nlmT | comC/blpC | positive effect |
| comB/nlmE | comC/blpC | positive effect |
| ciaH | comC/blpC | positive effect |
| sepM | comC/blpC | positive effect |
Sequence
Protein
Download Length: 304 a.a. Molecular weight: 35247.28 Da Isoelectric Point: 4.8341
MLKDFGKKIKSLRLEKGLTKEAVCLDESQLSTRQLTRIESGQSTPTLNKAVYIAGRLGVTLGYLTDGENVELPSRYKELK
YLLLRTPTYGDQQRLAEKETYFDEIFSQFYDDLPEEEQLIIDGLQSKLDIHFSDNIDFGVGILNDYFDQILRKTNYQVND
LILIDLYFSCLTVSGLDSAIFDSRKYNQLLETLLKQVDCLPLEDLFVLNNVLLNNFGLLLELKKYDFVKQLIAVSNKIMD
RTHDFQKKPIVNLLTWKHHLFVEKDYAEAKKSYDAAILFAQLTENINLRENLEKEWQKDSQNGT
Nucleotide
Download Length: 915 bp
ATGTTAAAAGATTTTGGGAAGAAAATTAAGAGCCTGAGGTTAGAAAAGGGGCTGACCAAAGAAGCTGTCTGCCTTGATGA
ATCTCAATTGTCAACACGGCAGTTGACCAGAATTGAATCAGGACAGTCTACGCCAACTCTTAATAAAGCTGTTTATATTG
CAGGACGTTTAGGAGTGACGCTTGGCTATTTAACGGACGGAGAAAATGTTGAGTTACCCAGTCGTTATAAAGAACTAAAG
TATTTATTATTACGAACGCCAACCTATGGCGACCAACAAAGATTAGCTGAAAAAGAAACCTATTTTGACGAGATTTTTAG
TCAGTTTTATGATGATTTGCCTGAAGAAGAACAATTGATTATTGATGGCTTACAATCGAAACTAGATATTCATTTTAGTG
ACAATATCGATTTTGGCGTTGGTATTTTAAATGACTATTTTGATCAGATTTTAAGAAAAACCAATTATCAGGTCAATGAT
TTGATTCTGATTGATCTCTATTTTTCCTGCTTAACTGTTAGTGGTTTGGATTCAGCTATTTTTGATTCAAGAAAATATAA
TCAATTATTGGAGACATTGCTTAAGCAGGTAGACTGCCTTCCATTGGAAGATCTTTTCGTTTTAAATAATGTTTTATTGA
ATAATTTTGGACTCCTCTTAGAATTGAAAAAATATGATTTTGTTAAGCAGCTTATTGCTGTCAGCAATAAAATCATGGAT
AGAACTCATGATTTTCAAAAAAAGCCTATTGTTAATCTTCTGACATGGAAGCATCATTTATTTGTTGAAAAAGATTATGC
GGAAGCTAAAAAGAGCTATGATGCTGCTATCTTATTTGCCCAGTTAACAGAAAACATTAATTTAAGAGAAAATTTGGAGA
AAGAATGGCAAAAAGATTCTCAGAACGGGACATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comR | Streptococcus infantarius subsp. infantarius ATCC BAA-102 |
53.125 |
98.63 |
0.524 |
| comR | Streptococcus pyogenes MGAS315 |
47.157 |
98.68 |
0.465 |
| comR | Streptococcus pyogenes MGAS8232 |
46.358 |
99.67 |
0.462 |
| comR | Streptococcus suis P1/7 |
43.813 |
100 |
0.438 |
| comR | Streptococcus suis 05ZYH33 |
43.813 |
98.355 |
0.431 |
| comR | Streptococcus suis D9 |
37 |
98.684 |
0.365 |
Multiple sequence alignment
References
| [1] | Antonio Pedro Ricomini Filho et al. (2019) Conserved Pheromone Production, Response and Degradation by Streptococcus mutans. Frontiers in Microbiology 10:2140. [PMID: 31572344] |
| [2] | Simon A M Underhill et al. (2018) Intracellular Signaling by the comRS System in Streptococcus mutans Genetic Competence. MSphere 3(5):e00444-18. [PMID: 30381353] |
| [3] | Iwona B Wenderska et al. (2017) Transcriptional Profiling of the Oral Pathogen Streptococcus mutans in Response to Competence Signaling Peptide XIP. MSystems 2(1):e00102-16. [PMID: 28066817] |
| [4] | Justin Kaspar et al. (2017) Intercellular Communication via the comX-Inducing Peptide (XIP) of Streptococcus mutans. Journal of Bacteriology 199(21):e00404-17. [PMID: 28808131] |
| [5] | R Khan et al. (2016) Comprehensive Transcriptome Profiles of Streptococcus mutans UA159 Map Core Streptococcal Competence Genes. MSystems 1(2):e00038-15. [PMID: 27822519] |
| [6] | Minjun Son et al. (2015) Bidirectional signaling in the competence regulatory pathway of Streptococcus mutans. FEMS Microbiology Letters 362(19):fnv159. [PMID: 26363019] |
| [7] | Kunal Desai et al. (2012) Development of competence for genetic transformation of Streptococcus mutans in a chemically defined medium. Journal of Bacteriology 194(15):3774-80. [PMID: 22609913] |
| [8] | Rabia Khan et al. (2012) Extracellular identification of a processed type II ComR/ComS pheromone of Streptococcus mutans. Journal of Bacteriology 194(15):3781-8. [PMID: 22609914] |
| [9] | Lauren Mashburn-Warren et al. (2010) A novel double-tryptophan peptide pheromone controls competence in Streptococcus spp. via an Rgg regulator. Molecular Microbiology 78(3):589-606. [PMID: 20969646] |