Detailed information NTG0000055

Experimentally validated

Overview

• Name: comE/blpR
• Type: Regulator
• Locus tag: SMU_RS08710
• Genome accession: NC_004350
• Coordinates: 1796612..1797364 (-)
• Length: 250 a.a.
• NCBI ID: WP_002262114.1
• Uniprot ID: Q8DS93
• Organism: Streptococcus mutans UA159
• Function: activate transcription of early competence genes; regulation of comX expression Competence regulation

Function

An homolog of the comCDE and blpCHR locus of S. pneumoniae, modulates competence and controls production of bacteriocin-like peptides. The comE gene encodes a response regulator that is phosphorylated by the histidine kinase ComD upon binding of the competence-stimulating peptide (CSP). ComE∼P is the active form of ComE, which recognizes and binds to a specific DNA motif, or ComE-box, upstream of early com genes and comX. By stimulating further transcription of early com genes, ComE∼P creates a positive amplification loop of the signal, which maintains the competent state for DNA uptake.

Genomic Context

Location: 1791612..1802364

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SMU_RS08680 (SMU.1909c)	-	1791628..1792032 (-)	405	WP_002263912.1	hypothetical protein	-
SMU_RS08685 (SMU.1910c)	-	1792179..1792598 (-)	420	WP_002263913.1	hypothetical protein	-
SMU_RS08690 (SMU.1913c)	-	1793979..1794380 (-)	402	WP_002310604.1	hypothetical protein	-
SMU_RS08695 (SMU.1914c)	cipB	1794511..1794741 (-)	231	WP_002265368.1	Blp family class II bacteriocin	Regulator
SMU_RS08700 (SMU.1915)	comC/blpC	1795008..1795148 (+)	141	WP_002267610.1	ComC/BlpC family leader-containing pheromone/bacteriocin	Regulator
SMU_RS08705 (SMU.1916)	comD/blpH	1795290..1796615 (-)	1326	WP_002262113.1	sensor histidine kinase	Regulator
SMU_RS08710 (SMU.1917)	comE/blpR	1796612..1797364 (-)	753	WP_002262114.1	response regulator transcription factor	Regulator
SMU_RS08715 (SMU.1918)	-	1797836..1798474 (-)	639	WP_002262115.1	VTT domain-containing protein	-
SMU_RS08720 (SMU.1919)	-	1798521..1799147 (-)	627	WP_002262116.1	hypothetical protein	-
SMU_RS08725 (SMU.1920)	der	1799222..1800532 (-)	1311	WP_002262117.1	ribosome biogenesis GTPase Der	-
SMU_RS08730 (SMU.1921)	dnaI	1800545..1801444 (-)	900	WP_002262118.1	primosomal protein DnaI	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comE/blpR	comD/blpH	positive effect
comD/blpH	comE/blpR	positive effect
comE/blpR	comC/blpC	positive effect
comE/blpR	comA/nlmT	positive effect
comE/blpR	comX/sigX	positive effect
comE/blpR	comE/blpR	positive effect
comE/blpR	comB/nlmE	positive effect
vicR	comE/blpR	negative effect
vicK	comE/blpR	negative effect
comD/blpH	comX/sigX	positive effect
comX/sigX	late competence genes	positive effect
scnR	comX/sigX	positive effect
hdrR	comX/sigX	positive effect
mecA	comX/sigX	negative effect
clpC	comX/sigX	negative effect
comR	comX/sigX	positive effect
clpP	comX/sigX	negative effect
XrpA	comX/sigX	negative effect
scnK	comX/sigX	positive effect
comS	comX/sigX	positive effect
vicK	comX/sigX	negative effect
scnC	comX/sigX	positive effect
brsR	comX/sigX	positive effect
cipB	comX/sigX	positive effect
vicR	comX/sigX	negative effect
comC/blpC	comX/sigX	positive effect
vicR	comD/blpH	negative effect
vicR	comC/blpC	negative effect
vicK	comD/blpH	negative effect
vicK	comC/blpC	negative effect
comC/blpC	comD/blpH	positive effect
comA/nlmT	comC/blpC	positive effect
comB/nlmE	comC/blpC	positive effect
ciaH	comC/blpC	positive effect
sepM	comC/blpC	positive effect
comX/sigX	late competence genes	positive effect
hdrR	comR	positive effect
hdrM	hdrR	negative effect
comR	comS	positive effect
cipB	comR	positive effect
XrpA	comR	negative effect
XrpA	comS	negative effect
comS	comS	positive effect
oppD	comS	positive effect
cipB	comS	positive effect
brsM	brsR	negative effect

Sequence

Protein

• Length: 250 a.a.
• Molecular weight: 29358.71 Da
• Isoelectric Point: 8.2551

>NTDB_id=55 SMU_RS08710 WP_002262114.1 1796612..1797364(-) (comE/blpR) [Streptococcus mutans UA159]
MISIFVLEDDFLQQGRLETTIAAIMKEKNWSYKELTIFGKPQQLIDAIPEKGNHQIFFLDIEIKKEEKKGLEVANQIRQH
NPSAVIVFVTTHSEFMPLTFQYQVSALDFIDKSLNPEEFSHRIESALYYAMENSQKNGQSEELFIFHSSETQFQVPFAEI
LYFETSSTAHKLCLYTYDERIEFYGSMTDIVKMDKRLFQCHRSFIVNPANITRIDRKKRLAYFRNNKSCLISRTKLTKLR
AVIADQRRAK

Nucleotide

• Length: 753 bp

>NTDB_id=55 SMU_RS08710 WP_002262114.1 1796612..1797364(-) (comE/blpR) [Streptococcus mutans UA159]
ATGATTTCTATTTTTGTATTGGAAGATGATTTTTTACAACAAGGACGTCTTGAAACCACCATTGCAGCTATCATGAAAGA
AAAAAATTGGTCTTATAAAGAATTGACTATTTTTGGAAAACCACAACAACTTATTGACGCTATCCCTGAAAAGGGCAATC
ACCAGATTTTCTTTTTGGATATTGAAATCAAAAAAGAGGAAAAGAAAGGACTGGAAGTAGCCAATCAGATTAGACAGCAT
AATCCTAGTGCAGTTATTGTCTTTGTCACGACACATTCTGAGTTTATGCCCCTCACTTTTCAGTATCAGGTATCTGCTTT
GGATTTTATTGATAAATCTTTGAATCCTGAGGAGTTCTCCCACCGCATTGAATCAGCGCTGTATTATGCTATGGAAAACA
GCCAGAAGAATGGTCAATCAGAGGAACTTTTTATTTTCCATTCATCTGAAACTCAGTTTCAGGTCCCTTTTGCTGAGATT
CTGTATTTTGAAACATCTTCAACAGCCCATAAGCTCTGCCTTTATACTTATGATGAACGGATTGAATTCTACGGCAGTAT
GACTGACATTGTTAAAATGGATAAGAGACTTTTTCAGTGCCATCGCTCTTTTATTGTCAATCCTGCCAATATTACCCGTA
TTGATCGGAAAAAACGCTTGGCCTATTTTCGAAATAATAAGTCTTGTCTTATTTCACGAACTAAGTTAACAAAACTGAGA
GCTGTGATTGCTGATCAAAGGAGAGCAAAATGA

Domains

Predicted by InterProScan.

• Response regulator receiver domain (Response_reg) (4-123)

• LytTr DNA-binding domain (LytTR) (153-242)

3D structure

• AlphaFold DB: Q8DS93

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE/comE1	Streptococcus equinus JB1	46.888	99.177	0.465
comE	Streptococcus infantis strain Atu-4	41.7	98.8	0.412
comE	Streptococcus mitis NCTC 12261	41.7	98.8	0.412
comE	Streptococcus mitis SK321	41.296	98.8	0.408
comE	Streptococcus pneumoniae Rx1	41.296	98.8	0.408
comE	Streptococcus pneumoniae D39	41.296	98.8	0.408
comE	Streptococcus pneumoniae R6	41.296	98.8	0.408
comE	Streptococcus pneumoniae TIGR4	41.296	98.8	0.408
comE/comE2	Streptococcus equinus JB1	40.664	98.77	0.402
comE/comE2	Streptococcus gordonii strain NCTC7865	37.551	98	0.368
comE/comE1	Streptococcus gordonii str. Challis substr. CH1	37.551	98	0.368

References

• [1]: Hemendra Pal Singh Dhaked et al. (2021) Redox Sensing Modulates the Activity of the ComE Response Regulator of Streptococcus mutans. Journal of Bacteriology 203(23):e0033021. [PMID: 34516285]
• [2]: David C I Hung et al. (2012) Oligomerization of the response regulator ComE from Streptococcus mutans is affected by phosphorylation. Journal of Bacteriology 194(5):1127-35. [PMID: 22210762]
• [3]: David C I Hung et al. (2011) Characterization of DNA binding sites of the ComE response regulator from Streptococcus mutans. Journal of Bacteriology 193(14):3642-52. [PMID: 21602345]
• [4]: Julie A Perry et al. (2009) Peptide alarmone signalling triggers an auto-active bacteriocin necessary for genetic competence. Molecular Microbiology 72(4):905-17. [PMID: 19400789]
• [5]: Jens Kreth et al. (2007) The response regulator ComE in Streptococcus mutans functions both as a transcription activator of mutacin production and repressor of CSP biosynthesis. Microbiology (Reading, England) 153(Pt 6):1799-1807. [PMID: 17526837]
• [6]: Jens Kreth et al. (2006) Cell density- and ComE-dependent expression of a group of mutacin and mutacin-like genes in Streptococcus mutans. FEMS Microbiology Letters 265(1):11-7. [PMID: 16981904]
• [7]: Y H Li et al. (2001) Natural genetic transformation of Streptococcus mutans growing in biofilms. Journal of Bacteriology 183(3):897-908. [PMID: 11208787]